1GHQ: CR2-C3D complex structure

CR2-C3D complex structure. Determined by X-ray diffraction at 2.04 Å resolution. Released 13 Jun 2001.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 3
Atoms: 5,132
Mol. weight: 64.49 kDa
Ligands: ZN, NDG
Released: 13 Jun 2001

Explore 1GHQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GHQ contains 29 α-helices and 46 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
α-helix	4-8	5
α-helix	20-38	19
α-helix	41-44	4
α-helix	46-48	3
α-helix	49-64	16
β-strand	67	1	2
β-strand	73	1	2
α-helix	80-82	3
α-helix	83-96	14
α-helix	104-118	15
β-strand	119	1	3
β-strand	125	1	3
α-helix	134-141	8
α-helix	146-165	20
α-helix	172-186	15
α-helix	187-189	3
α-helix	193-205	13
α-helix	211-220	10
β-strand	222	1	4
β-strand	226	1	4
α-helix	236-250	15
α-helix	256-265	10
α-helix	276-292	17
α-helix	293-295	3
α-helix	305	1
β-strand	306	1	1

Chain B: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	5
α-helix	7-9	3
β-strand	13-15	3	6
β-strand	22-23	2	5
β-strand	27-29	3	7
β-strand	30-32	3	6
β-strand	36-39	4	8
β-strand	43-45	3	7
β-strand	46-47	2	9
β-strand	55-56	2	9
β-strand	62-65	4	8
β-strand	71	1	10
α-helix	73-75	3
β-strand	80-84	5	11
β-strand	90	1	10
β-strand	94-99	6	11
α-helix	100	1
β-strand	104-106	3	12
β-strand	110-112	3	11
β-strand	113	1	13
β-strand	119	1	13
α-helix	123-125	3
β-strand	126-128	3	12

Chain C: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	14
α-helix	7-9	3
β-strand	13-15	3	15
β-strand	22-23	2	14
β-strand	27-29	3	16
β-strand	30-32	3	15
β-strand	36-39	4	17
β-strand	43-45	3	16
β-strand	46-47	2	18
β-strand	55-56	2	18
α-helix	59-61	3
β-strand	62-65	4	17
α-helix	66	1
β-strand	71-72	2	19
α-helix	73-75	3
β-strand	80-84	5	20
β-strand	89-90	2	19
β-strand	94-99	6	20
α-helix	100	1
β-strand	103-106	4	21
β-strand	110-112	3	20
β-strand	113	1	22
β-strand	119	1	22
α-helix	123-125	3
β-strand	126-129	4	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C3	A	protein	308	Homo sapiens	P01024 (AlphaFold model)
CR2/CD121/C3D/EPSTEIN-barr virus receptor	B, C	protein	134	Homo sapiens	P20023 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GHQ_1 COMPLEMENT C3 (chains A)
MLDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGY
TQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQK
PDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAG
DFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEAT
SYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPSDHQEL
NLDVSLQL

Sequence of entity 2 (B, C), FASTA

>1GHQ_2 CR2/CD121/C3D/EPSTEIN-BARR VIRUS RECEPTOR (chains B, C)
AISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPA
PKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWG
PTRLPTCVSVFPLE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
NDG	2-acetamido-2-deoxy-alpha-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structure of complement receptor 2 in complex with its C3d ligand. Szakonyi, G., Guthridge, J.M., Li, D. et al. Science (2001) 292:1725-1728. DOI 10.1126/science.1059118 · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4I6O 2.14 Å, Crystal structure of chemically synthesized human anaphylatoxin C3a
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
2GOX 2.2 Å, Crystal structure of Efb-C / C3d Complex
4ZH1 2.24 Å, Complement factor H in complex with the GM1 glycan

Browse structure collections

About this viewer

MolViewer shows 1GHQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.