2GOX: Efb-C / C3d Complex

Crystal structure of Efb-C / C3d Complex. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 Mar 2007.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Staphylococcus aureus subsp. aureus Mu50
Chains: 4
Atoms: 5,991
Mol. weight: 81.47 kDa
Released: 20 Mar 2007

Explore 2GOX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2GOX contains 46 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	993-996	4
α-helix	997-1003	7
α-helix	1013-1030	18
α-helix	1039-1057	19
β-strand	1060	1	1
β-strand	1066	1	1
α-helix	1073-1075	3
α-helix	1076-1089	14
α-helix	1097-1111	15
β-strand	1112	1	2
β-strand	1118	1	2
α-helix	1127-1129	3
α-helix	1131-1134	4
α-helix	1139-1158	20
α-helix	1165-1179	15
α-helix	1180-1182	3
α-helix	1186-1198	13
α-helix	1204-1213	10
β-strand	1215	1	3
β-strand	1219	1	3
α-helix	1226-1243	18
α-helix	1249-1257	9
α-helix	1269-1285	17

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	102-124	23
α-helix	127-139	13
α-helix	142-144	3
α-helix	145-161	17

Chain C: 21 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	994-996	3
α-helix	997-1003	7
α-helix	1013-1030	18
α-helix	1034-1037	4
α-helix	1039-1056	18
α-helix	1057-1059	3
β-strand	1060	1	4
β-strand	1066	1	4
α-helix	1073-1075	3
α-helix	1076-1088	13
α-helix	1089-1091	3
α-helix	1097-1106	10
α-helix	1107-1111	5
β-strand	1112	1	5
β-strand	1118	1	5
α-helix	1127-1129	3
α-helix	1131-1134	4
α-helix	1139-1158	20
α-helix	1165-1179	15
α-helix	1180-1182	3
α-helix	1186-1198	13
α-helix	1204-1213	10
β-strand	1215	1	6
β-strand	1219	1	6
α-helix	1226-1242	17
α-helix	1249-1259	11
α-helix	1269-1285	17

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	103-124	22
α-helix	127-139	13
α-helix	142-144	3
α-helix	145-161	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C3	A, C	protein	297	Homo sapiens	P01024 (AlphaFold model)
Fibrinogen-binding protein	B, D	protein	65	Staphylococcus aureus subsp. aureus Mu50	P68799 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2GOX_1 Complement C3 (chains A, C)
GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK
KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILE
KQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSIT
KAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNV
EATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP

Sequence of entity 2 (B, D), FASTA

>2GOX_2 Fibrinogen-binding protein (chains B, D)
TDATIKKEQKLIQAQNLVREFEKTHTVSAHRKAQKAVNLVSFEYKVKKMVLQERIDNVLK
QGLVR

Primary citation

A structural basis for complement inhibition by Staphylococcus aureus. Hammel, M., Sfyroera, G., Ricklin, D. et al. Nat Immunol (2007) 8:430-437. DOI 10.1038/ni1450 · PubMed

Other PDB entries of the same protein (UniProt P01024 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WY7 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
2WY8 1.7 Å, Staphylococcus aureus complement subversion protein Sbi-IV in complex with complement…
7UE9 1.75 Å, Structure of anti-C3d Fab(3d8b) in complex with C3d
1C3D 1.8 Å, X-ray crystal structure of C3D: a C3 fragment and ligand for complement receptor 2
6RMT 2.0 Å, Crystal structure of disulphide-linked human C3d dimer
7BAG 2.0 Å, C3b in complex with CP40
1GHQ 2.04 Å, CR2-C3D complex structure
3D5R 2.1 Å, Crystal Structure of Efb-C (N138A) / C3d Complex
3OXU 2.1 Å, Complement components factor H CCP19-20 and C3d in complex
4I6O 2.14 Å, Crystal structure of chemically synthesized human anaphylatoxin C3a
4ONT 2.15 Å, Ternary host recognition complex of complement factor H, C3d, and sialic acid
4ZH1 2.24 Å, Complement factor H in complex with the GM1 glycan

Browse structure collections

About this viewer

MolViewer shows 2GOX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.