Structure of active conformations of GIA1 and the mechanism of GTP hydrolysis. Determined by X-ray diffraction at 2.0 Å resolution. Released 30 Sept 1994.
Explore 1GIA in 3D Show helices and sheets RCSB PDB PDBe
1GIA contains 17 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 35-39 | 5 | 1 |
| α-helix | 46-57 | 12 | |
| α-helix | 63-90 | 28 | |
| α-helix | 100-115 | 16 | |
| α-helix | 121-132 | 12 | |
| α-helix | 134-140 | 7 | |
| α-helix | 143-145 | 3 | |
| α-helix | 152-156 | 5 | |
| α-helix | 159-162 | 4 | |
| α-helix | 171-176 | 6 | |
| β-strand | 184-191 | 8 | 1 |
| β-strand | 194-201 | 8 | 1 |
| α-helix | 208-214 | 7 | |
| β-strand | 220-226 | 7 | 1 |
| α-helix | 227-231 | 5 | |
| β-strand | 233-234 | 2 | 2 |
| β-strand | 237-241 | 5 | 2 |
| α-helix | 242-254 | 13 | |
| α-helix | 257-259 | 3 | |
| β-strand | 263-269 | 7 | 1 |
| α-helix | 271-277 | 7 | |
| α-helix | 283-285 | 3 | |
| α-helix | 296-308 | 13 | |
| β-strand | 319-323 | 5 | 1 |
| α-helix | 329-342 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| G protein gi alpha 1 | A | protein | 353 | Rattus norvegicus | P10824 (AlphaFold model) |
>1GIA_1 G PROTEIN GI ALPHA 1 (chains A) GCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGY SEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGAAEEGFMTA ELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKT TGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMN RMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAA YIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
| ID | Name | Formula | Copies |
|---|---|---|---|
| GSP | 5'-guanosine-diphosphate-monothiophosphate | C10 H16 N5 O13 P3 S | 1 |
| MG | Magnesium ion | Mg | 1 |
Structures of active conformations of Gi alpha 1 and the mechanism of GTP hydrolysis. Coleman, D.E., Berghuis, A.M., Lee, E. et al. Science (1994) 265:1405-1412. PubMed
Other PDB entries of the same protein (UniProt P10824 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.