1GMJ: Atpase inhibitor

Name: PDB 1GMJ: The structure of bovine IF1, the regulatory subunit of mitochondrial F-ATPase
Published: 2002-01-01
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: atpase inhibitor

The structure of bovine IF1, the regulatory subunit of mitochondrial F-ATPase. Determined by X-ray diffraction at 2.2 Å resolution. Released 1 Jan 2002.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: BOS TAURUS
Chains: 4
Atoms: 2,037
Mol. weight: 38.38 kDa
Released: 1 Jan 2002

Explore 1GMJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GMJ contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	20-82	63

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	21-78	58

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	21-77	57

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	27-77	51

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Atpase inhibitor	A, B, C, D	protein	84	BOS TAURUS	P01096 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1GMJ_1 ATPASE INHIBITOR (chains A, B, C, D)
GSESGDNVRSSAGAVRDAGGAFGKREQAEEERYFRARAKEQLAALKKHKENEISHHAKEI
ERLQKEIERHKQSIKKLKQSEDDD

Primary citation

The Structure of Bovine If(1), the Regulatory Subunit of Mitochondrial F-ATPase. Cabezon, E., Runswick, M.J., Leslie, A.G.W. et al. EMBO J (2001) 20:6990. DOI 10.1093/EMBOJ/20.24.6990 · PubMed

Other PDB entries of the same protein (UniProt P01096 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V7Q 2.1 Å, The structure of F1-ATPase inhibited by I1-60HIS, a monomeric form of the inhibitor…
9VPD 2.3 Å, Cryo-EM structure of the IF1 bound bovine ATP synthase monomer: rotary state 1, F1…
1OHH 2.8 Å, BOVINE MITOCHONDRIAL F1-ATPASE complexed with the inhibitor protein IF1
4TSF 3.2 Å, The Pathway of Binding of the Intrinsically Disordered Mitochondrial Inhibitor Protein…
4TT3 3.21 Å, The Pathway of Binding of the Intrinsically Disordered Mitochondrial Inhibitor Protein…
6YY0 3.23 Å, bovine ATP synthase F1-peripheral stalk domain, state 1
6Z1R 3.29 Å, bovine ATP synthase F1-peripheral stalk domain, state 2
6ZQM 3.29 Å, bovine ATP synthase monomer state 2 (combined)
4Z1M 3.3 Å, Bovine F1-ATPase inhibited by three copies of the inhibitor protein IF1 crystallised in…
9W2R 3.4 Å, Cryo-EM structure of FoF1-ATPase monomer state 1 on the bovine heart submitochondrial…
6Z1U 3.47 Å, bovine ATP synthase F1c8-peripheral stalk domain, state 3
6ZPO 4.0 Å, bovine ATP synthase monomer state 1 (combined)

Browse structure collections

About this viewer

MolViewer shows 1GMJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.