1GY6: NTF2 from rat, ammonium sulphate conditions

NTF2 from rat, ammonium sulphate conditions. Determined by X-ray diffraction at 1.6 Å resolution. Released 20 Jun 2002.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: RATTUS NORVEGICUS
Chains: 2
Atoms: 2,177
Mol. weight: 28.98 kDa
Released: 20 Jun 2002

Explore 1GY6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GY6 contains 8 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-25	20
α-helix	26-32	7
β-strand	33-41	9	1
β-strand	44-47	4	1
α-helix	49-58	10
β-strand	64-75	12	1
β-strand	81-91	11	1
α-helix	95-96	2
β-strand	97-108	12	1
β-strand	111-121	11	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-25	20
α-helix	26-32	7
β-strand	33-41	9	2
β-strand	44-47	4	2
α-helix	49-58	10
β-strand	64-75	12	2
β-strand	81-91	11	2
α-helix	95-96	2
β-strand	97-107	11	2
β-strand	112-121	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear transport factor 2	A, B	protein	127	RATTUS NORVEGICUS	P61972 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1GY6_1 NUCLEAR TRANSPORT FACTOR 2 (chains A, B)
MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLP
FQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFR
LALHNFG

Primary citation

Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats. Bayliss, R., Leung, S., Baker, R. et al. EMBO J (2002) 21:2843. DOI 10.1093/EMBOJ/CDF305 · PubMed

Other PDB entries of the same protein (UniProt P61972 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JB2 2.0 Å, Crystal structure of NTF2 M84E mutant
1JB4 2.23 Å, Crystal structure of NTF2 M102E mutant
1AR0 2.3 Å, Nuclear transport factor 2 (NTF2) E42K mutant
1ASK 2.3 Å, Nuclear transport factor 2 (NTF2) H66A mutant
1JB5 2.3 Å, Crystal structure of NTF2 M118E mutant
1OUN 2.3 Å, Crystal structure of nuclear transport factor 2 (NTF2)
1QMA 2.5 Å, Nuclear Transport Factor 2 (NTF2) W7A mutant
1U5O 2.5 Å, Structure of the D23A mutant of the nuclear transport carrier NTF2
5BXQ 2.5 Å, Structure of the NTF2:RanGDP complex

Browse structure collections

About this viewer

MolViewer shows 1GY6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.