Epsin ENTH bound to Ins(1,4,5)P3. Determined by X-ray diffraction at 1.7 Å resolution. Released 3 Oct 2002.
Explore 1H0A in 3D Show helices and sheets RCSB PDB PDBe
1H0A contains 12 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-15 | 14 | |
| α-helix | 19-27 | 9 | |
| α-helix | 34-36 | 3 | |
| α-helix | 37-46 | 10 | |
| α-helix | 50-64 | 15 | |
| α-helix | 68-70 | 3 | |
| α-helix | 71-87 | 17 | |
| α-helix | 90-98 | 9 | |
| α-helix | 100-105 | 6 | |
| α-helix | 106-108 | 3 | |
| β-strand | 112 | 1 | 1 |
| β-strand | 118 | 1 | 1 |
| α-helix | 121-134 | 14 | |
| α-helix | 137-156 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Epsin | A | protein | 158 | RATTUS NORVEGICUS | O88339 (AlphaFold model) |
>1H0A_1 EPSIN (chains A) MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA
| ID | Name | Formula | Copies |
|---|---|---|---|
| DIO | 1,4-diethylene dioxide | C4 H8 O2 | 5 |
| I3P | D-myo-inositol-1,4,5-triphosphate | C6 H15 O15 P3 | 1 |
Curvature of Clathrin-Coated Pits Driven by Epsin. Ford, M.G.J., Mills, I., Peter, B. et al. Nature (2002) 419:361. DOI 10.1038/NATURE01020 · PubMed
Other PDB entries of the same protein (UniProt O88339 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1H0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.