1H10: Rac-alpha serine/threonine kinase

High resolution structure of the pleckstrin homology domain of protein kinase b/akt bound to INS(1,3,4,5)-tetrakisphophate. Determined by X-ray diffraction at 1.4 Å resolution. Released 27 Jun 2003.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,266
Mol. weight: 15.44 kDa
Ligands: 4IP
Released: 27 Jun 2003

Explore 1H10 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H10 contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6-15	10	1
β-strand	22-30	9	1
β-strand	34-38	5	1
α-helix	45-48	4
β-strand	53-56	4	1
β-strand	61-65	5	1
β-strand	72-79	8	1
β-strand	82-89	8	1
α-helix	93-115	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rac-alpha serine/threonine kinase	A	protein	125	HOMO SAPIENS	P31749 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1H10_1 RAC-ALPHA SERINE/THREONINE KINASE (chains A)
XSMSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVA
QCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEM
DFRSG

Ligands and cofactors

ID	Name	Formula	Copies
4IP	Inositol-(1,3,4,5)-tetrakisphosphate	C6 H16 O18 P4	1

Primary citation

High Resolution Structure of the Pleckstrin Homology Domain of Protein Kinase B/Akt Bound to Phosphatidylinositol (3,4,5)-Trisphosphate. Thomas, C.C., Deak, M., Alessi, D.R. et al. Curr Biol (2002) 12:1256. DOI 10.1016/S0960-9822(02)00972-7 · PubMed

Other PDB entries of the same protein (UniProt P31749 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UNQ 0.98 Å, High resolution crystal structure of the Pleckstrin Homology Domain Of Protein Kinase…
1UNR 1.25 Å, Crystal structure of the PH domain of PKB alpha in complex with a sulfate molecule
7MYX 1.39 Å, Crystal structure of the PH domain (R86A) of Akt1
8JOW 1.4 Å, Crystal structure of rabbit antibody with phosphorylated peptide bound
4GV1 1.49 Å, PKB alpha in complex with AZD5363
1UNP 1.65 Å, Crystal structure of the pleckstrin homology domain of PKB alpha
3QKL 1.9 Å, Spirochromane Akt Inhibitors
7NH5 1.9 Å, Co-Crystal Structure of Akt1 in Complex with Covalent-Allosteric Akt Inhibitor 6
8UW9 1.9 Å, Structure of AKT1(E17K) with compound 4
9TMV 1.9 Å, Akt1 mutant in complex with the 3-ethyl 1-methyl 1,4-substituted pyrazole containing…
2UVM 1.94 Å, Structure of PKBalpha PH domain in complex with a novel inositol headgroup surrogate,…
2UZR 1.94 Å, A transforming mutation in the pleckstrin homology domain of AKT1 in cancer (AKT1-PH_E17K)

Browse structure collections

About this viewer

MolViewer shows 1H10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.