Human CD55 domains 3 & 4. Determined by X-ray diffraction at 3.0 Å resolution. Released 25 Sept 2003.
Explore 1H2Q in 3D Show helices and sheets RCSB PDB PDBe
1H2Q contains 2 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| α-helix | 7-9 | 3 | |
| β-strand | 16-19 | 4 | 2 |
| β-strand | 25 | 1 | 1 |
| β-strand | 29-34 | 6 | 2 |
| β-strand | 38-41 | 4 | 3 |
| β-strand | 45-47 | 3 | 2 |
| β-strand | 48 | 1 | 4 |
| β-strand | 57 | 1 | 4 |
| β-strand | 63-66 | 4 | 3 |
| α-helix | 69-73 | 5 | |
| β-strand | 75 | 1 | 5 |
| β-strand | 78-80 | 3 | 5 |
| β-strand | 92-94 | 3 | 6 |
| β-strand | 95-97 | 3 | 5 |
| β-strand | 102-104 | 3 | 7 |
| β-strand | 108-110 | 3 | 6 |
| β-strand | 111-113 | 3 | 8 |
| β-strand | 118-120 | 3 | 8 |
| β-strand | 126-128 | 3 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Complement decay-accelerating factor | P | protein | 125 | HOMO SAPIENS | P08174 (AlphaFold model) |
>1H2Q_1 COMPLEMENT DECAY-ACCELERATING FACTOR (chains P) KSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPEC REIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPP PECRG
Mapping Cd55 Function. The Structure of Two Pathogen-Binding Domains at 1.7 A. Williams, P., Chaudhry, Y., Goodfellow, I.G. et al. J Biol Chem (2003) 278:10691. DOI 10.1074/JBC.M212561200 · PubMed
Other PDB entries of the same protein (UniProt P08174 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1H2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.