1H2Q: Human CD55 domains 3 & 4

Human CD55 domains 3 & 4. Determined by X-ray diffraction at 3.0 Å resolution. Released 25 Sept 2003.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 889
Mol. weight: 13.59 kDa
Released: 25 Sept 2003

Explore 1H2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1H2Q contains 2 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 2 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
α-helix	7-9	3
β-strand	16-19	4	2
β-strand	25	1	1
β-strand	29-34	6	2
β-strand	38-41	4	3
β-strand	45-47	3	2
β-strand	48	1	4
β-strand	57	1	4
β-strand	63-66	4	3
α-helix	69-73	5
β-strand	75	1	5
β-strand	78-80	3	5
β-strand	92-94	3	6
β-strand	95-97	3	5
β-strand	102-104	3	7
β-strand	108-110	3	6
β-strand	111-113	3	8
β-strand	118-120	3	8
β-strand	126-128	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement decay-accelerating factor	P	protein	125	HOMO SAPIENS	P08174 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>1H2Q_1 COMPLEMENT DECAY-ACCELERATING FACTOR (chains P)
KSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPEC
REIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPP
PECRG

Primary citation

Mapping Cd55 Function. The Structure of Two Pathogen-Binding Domains at 1.7 A. Williams, P., Chaudhry, Y., Goodfellow, I.G. et al. J Biol Chem (2003) 278:10691. DOI 10.1074/JBC.M212561200 · PubMed

Other PDB entries of the same protein (UniProt P08174 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1H03 1.7 Å, Human CD55 domains 3 & 4
1H04 2.0 Å, Human CD55 domains 3 & 4
1OK3 2.2 Å, Decay accelerating factor (cd55): the structure of an intact human complement regulator.
1OJV 2.3 Å, Decay accelerating factor (CD55): the structure of an intact human complement regulator.
1OJW 2.3 Å, Decay accelerating factor (CD55): the structure of an intact human complement regulator.
1OK2 2.5 Å, Decay accelerating factor (CD55): the structure of an intact human complement regulator.
1OJY 2.6 Å, Decay accelerating factor (cd55): the structure of an intact human complement regulator.
1OK1 2.6 Å, Decay accelerating factor (cd55) : the structure of an intact human complement regulator.
8K9T 2.66 Å, Cryo-EM structure of the products-bound PGAP1(Bst1)-S327A from Chaetonium thermophilum
8K9R 2.68 Å, Cryo EM structure of the products-bound PGAP1(Bst1)-H443N from Chaetomium thermophilum
1H2P 2.8 Å, Human CD55 domains 3 & 4
6LA5 2.86 Å, Cryo-EM structure of echovirus 11 complexed with its attaching receptor CD55 at pH 7.4

Browse structure collections

About this viewer

MolViewer shows 1H2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.