Lumen-side domain of reduced cytochrome F at-35 degrees celsius. Determined by X-ray diffraction at 1.96 Å resolution. Released 12 Mar 1997.
Explore 1HCZ in 3D Show helices and sheets RCSB PDB PDBe
1HCZ contains 9 α-helices and 25 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-8 | 7 | |
| β-strand | 13 | 1 | 1 |
| β-strand | 19 | 1 | 1 |
| α-helix | 20-23 | 4 | |
| β-strand | 28 | 1 | 2 |
| β-strand | 32-34 | 3 | 3 |
| β-strand | 38-39 | 2 | 2 |
| β-strand | 44-50 | 7 | 3 |
| β-strand | 59-60 | 2 | 4 |
| β-strand | 66-67 | 2 | 4 |
| β-strand | 70-76 | 7 | 2 |
| α-helix | 77-78 | 2 | |
| β-strand | 82-83 | 2 | 3 |
| α-helix | 84-85 | 2 | |
| α-helix | 86-88 | 3 | |
| α-helix | 91-97 | 7 | |
| β-strand | 103-106 | 4 | 2 |
| β-strand | 109-119 | 11 | 2 |
| α-helix | 120-123 | 4 | |
| β-strand | 125-131 | 7 | 3 |
| β-strand | 145-154 | 10 | 2 |
| β-strand | 159 | 1 | 5 |
| β-strand | 165 | 1 | 5 |
| β-strand | 172 | 1 | 6 |
| β-strand | 177-184 | 8 | 7 |
| α-helix | 185 | 1 | |
| β-strand | 190-196 | 7 | 7 |
| β-strand | 201-207 | 7 | 7 |
| α-helix | 211-212 | 2 | |
| β-strand | 213 | 1 | 8 |
| β-strand | 220-221 | 2 | 7 |
| β-strand | 226 | 1 | 6 |
| β-strand | 228 | 1 | 8 |
| β-strand | 235-245 | 11 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome F | A | protein | 252 | Brassica rapa | P36438 (AlphaFold model) |
>1HCZ_1 CYTOCHROME F (chains A) YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEC | Heme C | C34 H36 Fe N4 O4 | 1 |
The heme redox center of chloroplast cytochrome f is linked to a buried five-water chain. Martinez, S.E., Huang, D., Ponomarev, M. et al. Protein Sci (1996) 5:1081-1092. PubMed
Other PDB entries of the same protein (UniProt P36438 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1HCZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.