1HH9: Anti-P24 (HIV-1) FAB fragment CB41

Anti-P24 (HIV-1) FAB fragment CB41 complexed with a peptide. Determined by X-ray diffraction at 2.7 Å resolution. Released 12 Jan 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: MUS MUSCULUS, synthetic construct
Chains: 3
Atoms: 3,401
Mol. weight: 47.78 kDa
Released: 12 Jan 2001

Explore 1HH9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HH9 contains 15 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
α-helix	43-44	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-66	5	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	144-150	7	5
β-strand	153-155	3	5
β-strand	159-163	5	4
α-helix	165-167	3
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-198	8	5
β-strand	201-210	10	5
α-helix	211-213	3

Chain B: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
β-strand	18-25	8	6
β-strand	34-40	7	7
β-strand	44-52	9	7
β-strand	57-60	4	7
α-helix	62-64	3
β-strand	65	1	6
β-strand	68-73	6	6
β-strand	78-83	6	6
β-strand	92-97	6	7
β-strand	102	1	7
β-strand	106-110	5	7
α-helix	113-115	3
β-strand	116	1	8
α-helix	117-118	2
β-strand	119-123	5	9
β-strand	134-144	11	9
β-strand	145	1	8
β-strand	151-153	3	10
α-helix	154-156	3
β-strand	158	1	10
β-strand	162-164	3	9
α-helix	165-167	3
β-strand	168-170	3	9
β-strand	173-183	11	9
β-strand	193-198	6	10
β-strand	203-208	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IGG2A kappa antibody CB41 (light chain)	A	protein	214	MUS MUSCULUS	P01837 (AlphaFold model)
IGG2A kappa antibody CB41 (heavy chain)	B	protein	213	MUS MUSCULUS	P01864 (AlphaFold model)
PEP-2	C	protein	12	synthetic construct

Sequence of entity 1 (A), FASTA

>1HH9_1 IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN) (chains A)
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPS
RFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B), FASTA

>1HH9_2 IGG2A KAPPA ANTIBODY CB41 (HEAVY CHAIN) (chains B)
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAY
NQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSV
YPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSV
TVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV

Sequence of entity 3 (C), FASTA

>1HH9_3 PEP-2 (chains C)
DATPEDLNAKLX

Primary citation

Evolutionary Transition Pathways for Changing Peptide Ligand Specificity and Structure. Hoffmuller, U., Knaute, T., Hahn, M. et al. EMBO J (2000) 19:4866. DOI 10.1093/EMBOJ/19.18.4866 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1HH9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.