1HJ1: Oestrogen receptor beta

Rat oestrogen receptor beta ligand-binding domain in complex with pure antioestrogen ICI164,384. Determined by X-ray diffraction at 2.3 Å resolution. Released 4 Jan 2002.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: RATTUS NORVEGICUS
Chains: 1
Atoms: 1,696
Mol. weight: 29.72 kDa
Ligands: AOE, PMB, NI
Released: 4 Jan 2002

Explore 1HJ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HJ1 contains 10 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	220-230	11
α-helix	231-235	5
α-helix	243-244	2
α-helix	246-269	24
α-helix	279-301	23
β-strand	308-312	5	1
β-strand	315-318	4	1
α-helix	319-324	6
α-helix	328-344	17
α-helix	349-361	13
α-helix	379-397	19
α-helix	403-434	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oestrogen receptor beta	A	protein	255	RATTUS NORVEGICUS	Q62986 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HJ1_1 OESTROGEN RECEPTOR BETA (chains A)
VKELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAK
KIPGFVELSLLDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGIL
EIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVT
DALVWVIAKSGISSQQQSVRLANLLMLLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEM
LNAHLTRGYKSSISG

Ligands and cofactors

ID	Name	Formula	Copies
AOE	N-butyl-11-[(7R,8R,9S,13S,14S,17S)-3,17-dihydroxy-13-methyl-7,8,9,11,12,13,14,1…	C34 H55 N O3	1
PMB	Para-mercury-benzenesulfonic acid	C6 H5 Cl Hg O3 S	1
NI	Nickel (II) ion	Ni	2

Primary citation

Structural Insights Into the Mode of Action of a Pure Antiestrogen. Pike, A.C.W., Brzozowski, A.M., Walton, J. et al. Structure (2001) 9:145. DOI 10.1016/S0969-2126(01)00568-8 · PubMed

Other PDB entries of the same protein (UniProt Q62986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J7Y 1.8 Å, Structure of 17-epiestriol-bound estrogen receptor beta lbd in complex with lxxll motif…
2J7X 2.1 Å, Structure of estradiol-bound estrogen receptor beta lbd in complex with lxxll motif from…
1QKN 2.25 Å, Rat oestrogen receptor beta ligand-binding domain in complex with antagonist raloxifene

Browse structure collections

About this viewer

MolViewer shows 1HJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.