1QKN: Estrogen receptor beta

Rat oestrogen receptor beta ligand-binding domain in complex with antagonist raloxifene. Determined by X-ray diffraction at 2.25 Å resolution. Released 28 Jul 2000.

Method: X-ray diffraction
Resolution: 2.25 Å
Organism: RATTUS NORVEGICUS
Chains: 1
Atoms: 1,939
Mol. weight: 29.22 kDa
Ligands: RAL
Released: 28 Jul 2000

Explore 1QKN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QKN contains 12 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	220-230	11
α-helix	231-234	4
β-strand	238	1	1
α-helix	246-270	25
α-helix	274-276	3
α-helix	279-302	24
β-strand	308-312	5	2
β-strand	314	1	1
β-strand	315-318	4	2
α-helix	319-323	5
α-helix	329-344	16
α-helix	349-361	13
α-helix	363-365	3
α-helix	371-397	27
α-helix	403-432	30
α-helix	446-451	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Estrogen receptor beta	A	protein	255	RATTUS NORVEGICUS	Q62986 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QKN_1 ESTROGEN RECEPTOR BETA (chains A)
VKELLLSTLSPEQLVLTLLEAEPPNVLVSRPSMPFTEASMMMSLTKLADKELVHMIGWAK
KIPGFVELSLLDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLVLDRDEGKCVEGIL
EIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLASANQEAESSRKLTHLLNAVT
DALVWVIAKSGISSQQQSVRLANLLMLLSHVRHISNKGMEHLLSMKCKNVVPVYDLLLEM
LNAHLTRGYKSSISG

Ligands and cofactors

ID	Name	Formula	Copies
RAL	Raloxifene	C28 H27 N O4 S	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Structure of the Ligand-Binding Domain of Oestrogen Receptor Beta in the Presence of a Partial Agonist and a Full Antagonist. Pike, A.C.W., Brzozowski, A.M., Hubbard, R.E. et al. EMBO J (1999) 18:4608. DOI 10.1093/EMBOJ/18.17.4608 · PubMed

Other PDB entries of the same protein (UniProt Q62986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J7Y 1.8 Å, Structure of 17-epiestriol-bound estrogen receptor beta lbd in complex with lxxll motif…
2J7X 2.1 Å, Structure of estradiol-bound estrogen receptor beta lbd in complex with lxxll motif from…
1HJ1 2.3 Å, Rat oestrogen receptor beta ligand-binding domain in complex with pure antioestrogen…

Browse structure collections

About this viewer

MolViewer shows 1QKN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.