1HOV: Catalytic domain of mmp-2

Solution structure of a catalytic domain of mmp-2 complexed with sc-74020. Determined by solution NMR. Released 12 Dec 2001.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,354
Mol. weight: 19.28 kDa
Ligands: I52, CA, ZN
Released: 12 Dec 2001

Explore 1HOV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HOV contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	16-20	5	1
α-helix	29-44	16
β-strand	51-53	3	1
β-strand	61-65	5	1
β-strand	84-86	3	1
α-helix	87-88	2
β-strand	97-99	3	1
α-helix	114-124	11
α-helix	152-161	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix metalloproteinase-2	A	protein	163	Homo sapiens	P08253 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HOV_1 MATRIX METALLOPROTEINASE-2 (chains A)
MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEAD
IMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAH
EFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG

Ligands and cofactors

ID	Name	Formula	Copies
I52	N-{4-[(1-hydroxycarbamoyl-2-methyl-propyl)-(2-morpholin-4-yl-ethyl)-sulfamoyl]-…	C29 H42 N4 O6 S	1
CA	Calcium ion	Ca	2
ZN	Zinc ion	Zn	2

Primary citation

Solution structure and backbone dynamics of the catalytic domain of matrix metalloproteinase-2 complexed with a hydroxamic acid inhibitor. Feng, Y., Likos, J.J., Zhu, L. et al. Biochim Biophys Acta (2002) 1598:10-23. DOI 10.1016/S0167-4838(02)00307-2 · PubMed

Other PDB entries of the same protein (UniProt P08253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AYU 2.0 Å, Crystal structure of MMP-2 active site mutant in complex with APP-drived decapeptide…
7XJO 2.0 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GEN 2.15 Å, C-terminal domain of gelatinase a
8H78 2.4 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1RTG 2.6 Å, C-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2
1EAK 2.66 Å, Catalytic domain of proMMP-2 E404Q mutant
1CK7 2.8 Å, Gelatinase a (full-length)
1QIB 2.8 Å, Crystal structure of gelatinase a catalytic domain
7XGJ 2.8 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GXD 3.1 Å, proMMP-2/TIMP-2 complex
1CXW The second type II module from human matrix metalloproteinase 2
1J7M The Third Fibronectin Type II Module from Human Matrix Metalloproteinase 2

Browse structure collections

About this viewer

MolViewer shows 1HOV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.