1QIB: Gelatinase a catalytic domain

Crystal structure of gelatinase a catalytic domain. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Nov 1999.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,282
Mol. weight: 18.21 kDa
Ligands: ZN, CA
Released: 19 Nov 1999

Explore 1QIB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QIB contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	96-101	6	1
α-helix	110-125	16
β-strand	131-134	4	1
β-strand	142-147	6	1
β-strand	165-167	3	1
α-helix	168-169	2
β-strand	178-181	4	1
β-strand	186-187	2	2
β-strand	193-194	2	2
α-helix	195-207	13
α-helix	236-246	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
72 kDa type IV collagenase	A	protein	161	Homo sapiens	P08253 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QIB_1 72 kDa type IV collagenase (chains A)
RKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFG
RWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWSLGKGVGYSLFLVAAHEFGHA
MGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASP

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
CA	Calcium ion	Ca	3

Primary citation

X-ray structure of gelatinase A catalytic domain complexed with a hydroxamate inhibitor. Dhanaraj, V., Williams, M.G., Ye, Q.-Z. et al. Croat Chem Acta (1999) 72:575-591. PubMed

Other PDB entries of the same protein (UniProt P08253 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AYU 2.0 Å, Crystal structure of MMP-2 active site mutant in complex with APP-drived decapeptide…
7XJO 2.0 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GEN 2.15 Å, C-terminal domain of gelatinase a
8H78 2.4 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1RTG 2.6 Å, C-terminal domain (haemopexin-like domain) of human matrix metalloproteinase-2
1EAK 2.66 Å, Catalytic domain of proMMP-2 E404Q mutant
1CK7 2.8 Å, Gelatinase a (full-length)
7XGJ 2.8 Å, Crystal structure of human MMP-2 catalytic domain in complex with inhibitor
1GXD 3.1 Å, proMMP-2/TIMP-2 complex
1CXW The second type II module from human matrix metalloproteinase 2
1HOV Solution structure of a catalytic domain of mmp-2 complexed with sc-74020
1J7M The Third Fibronectin Type II Module from Human Matrix Metalloproteinase 2

Browse structure collections

About this viewer

MolViewer shows 1QIB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.