1HQ1: Signal recognition particle protein

Structural and energetic analysis of RNA recognition by a universally conserved protein from the signal recognition particle. Determined by X-ray diffraction at 1.52 Å resolution. Released 3 Jan 2001.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Escherichia coli
Chains: 2
Atoms: 1,954
Mol. weight: 28.19 kDa
Ligands: MG
Released: 3 Jan 2001

Explore 1HQ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HQ1 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	4-11	8
α-helix	25-33	9
α-helix	37-41	5
α-helix	43-45	3
α-helix	48-58	11
α-helix	62-82	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4.5S RNA domain IV	B	RNA	49
Signal recognition particle protein	A	protein	105	Escherichia coli	P0AGD7 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1HQ1_1 4.5S RNA DOMAIN IV (chains B)
GGCUCUGUUUACCAGGUCAGGUCCGAAAGGAAGCAGCCAAGGCAGAGCC

Sequence of entity 2 (A), FASTA

>1HQ1_2 SIGNAL RECOGNITION PARTICLE PROTEIN (chains A)
GFDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKE
RAKPEIIKGSRKRRIAAGSGMQVQDVNRLLKQFDDMQRMMKKMKK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Water and common crystallization additives (K) are not listed.

Primary citation

Structural and energetic analysis of RNA recognition by a universally conserved protein from the signal recognition particle. Batey, R.T., Sagar, M.B., Doudna, J.A. J Mol Biol (2001) 307:229-246. DOI 10.1006/jmbi.2000.4454 · PubMed

Other PDB entries of the same protein (UniProt P0AGD7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DUL 1.8 Å, Structure of the ribonucleoprotein core of the E. Coli signal recognition particle
3LQX 1.93 Å, SRP ribonucleoprotein core complexed with cobalt hexammine
2PXD 2.0 Å, Variant 1 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXE 2.0 Å, Variant 4 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXF 2.0 Å, Variant 5 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXV 2.0 Å, Variant 6 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
7O9I 2.49 Å, Escherichia coli Ffh in complex with pppGpp
2PXB 2.5 Å, Variant 2 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXK 2.5 Å, Variant 8 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXL 2.5 Å, Variant 9 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXP 2.5 Å, Variant 13 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle
2PXQ 2.5 Å, Variant 14 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle

Browse structure collections

About this viewer

MolViewer shows 1HQ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.