1HTM: Hemagglutinin HA1 chain

Structure of influenza haemagglutinin at the PH of membrane fusion. Determined by X-ray diffraction at 2.5 Å resolution. Released 14 Feb 1995.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: uncultured beta proteobacterium UMTRA-608
Chains: 6
Atoms: 3,129
Mol. weight: 57.13 kDa
Released: 14 Feb 1995

Explore 1HTM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HTM contains 9 α-helices and 9 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	13-14	2	1

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	41-104	64
α-helix	113-128	16
β-strand	131-132	2	1
β-strand	137-139	3	1
α-helix	146-151	6

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	12-14	3	2

Chain D: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	41-101	61
α-helix	113-129	17
β-strand	131-133	3	2
β-strand	137-139	3	2
α-helix	146-153	8

Chain E: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	11-14	4	3

Chain F: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	41-104	64
α-helix	113-126	14
β-strand	131-132	2	3
β-strand	137-140	4	3
α-helix	146-154	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hemagglutinin HA1 chain	A, C, E	protein	27	uncultured beta proteobacterium UMTRA-608	P03437
Hemagglutinin HA2 chain	B, D, F	protein	138	uncultured beta proteobacterium UMTRA-608	P03437

Sequence of entity 1 (A, C, E), FASTA

>1HTM_1 HEMAGGLUTININ HA1 CHAIN (chains A, C, E)
QDLPGNDNSTATLCLGHHAVPNGTLVK

Sequence of entity 2 (B, D, F), FASTA

>1HTM_2 HEMAGGLUTININ HA2 CHAIN (chains B, D, F)
LKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAE
LLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTY
DHDVYRDEALNNRFQIKG

Primary citation

Structure of influenza haemagglutinin at the pH of membrane fusion. Bullough, P.A., Hughson, F.M., Skehel, J.J. et al. Nature (1994) 371:37-43. DOI 10.1038/371037a0 · PubMed

Other PDB entries of the same protein (UniProt P03437), best resolution first:

8PJF 1.48 Å, Human Leukocyte Antigen class II allotype DR1 presenting P11T->R modified influenza A…
8PJE 1.7 Å, Human Leukocyte Antigen class II allotype DR1 presenting influenza A virus…
8PJG 1.83 Å, F11 TCR in complex with Human Leukocyte Antigen class II allotype DR1 presenting P11T->R…
1QU1 1.9 Å, Crystal structure of EHA2 (23-185)
6E56 2.0 Å, Human antibody H2214 in complex with influenza hemagglutinin A/Aichi/2/1968 (X-31) (H3N2)
1PYW 2.1 Å, Human class II MHC protein HLA-DR1 bound to a designed peptide related to influenza…
3S5L 2.1 Å, Crystal structure of CD4 mutant bound to HLA-DR1
1J8H 2.4 Å, Crystal Structure of a Complex of a Human alpha/beta-T cell Receptor, Influenza HA…
3S4S 2.4 Å, Crystal structure of CD4 mutant bound to HLA-DR1
2VIU 2.5 Å, Influenza virus hemagglutinin
6XPX 2.6 Å, Human antibody S1V2-51 in complex with the influenza hemagglutinin head domain of…
1FYT 2.6 Å, Crystal structure of a complex of a human alpha/beta-T cell receptor, influenza ha…

Browse structure collections

About this viewer

MolViewer shows 1HTM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.