1HTN: Tetranectin

Human tetranectin, a trimeric plasminogen binding protein with an alpha-helical coiled coil. Determined by X-ray diffraction at 2.8 Å resolution. Released 3 Dec 1997.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,250
Mol. weight: 20.35 kDa
Ligands: CA
Released: 3 Dec 1997

Explore 1HTN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HTN contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	27-52	26
β-strand	54-56	3	1
β-strand	59-68	10	1
α-helix	70-78	9
β-strand	83-84	2	1
α-helix	90-103	14
β-strand	109-115	7	2
β-strand	124	1	2
α-helix	129	1
β-strand	130	1	2
α-helix	131	1
β-strand	136	1	2
β-strand	152-156	5	2
β-strand	162-166	5	2
β-strand	172-179	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tetranectin	A	protein	182	Homo sapiens	P05452 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HTN_1 TETRANECTIN (chains A)
GEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLSQEVALLKEQQALQTVCLKGTKVHMK
CFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAA
EGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFG
IV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil. Nielsen, B.B., Kastrup, J.S., Rasmussen, H. et al. FEBS Lett (1997) 412:388-396. DOI 10.1016/S0014-5793(97)00664-9 · PubMed

Other PDB entries of the same protein (UniProt P05452 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TN3 2.0 Å, The C-type lectin carbohydrate recognition domain of human tetranectin
3L9J 2.1 Å, Selection of a novel highly specific TNFalpha antagonist: Insight from the crystal…
1RJH Structure of the Calcium Free Form of the C-type Lectin-like Domain of Tetranectin

Browse structure collections

About this viewer

MolViewer shows 1HTN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.