Structure of the Calcium Free Form of the C-type Lectin-like Domain of Tetranectin. Determined by solution NMR. Released 20 Jul 2004.
Explore 1RJH in 3D Show helices and sheets RCSB PDB PDBe
1RJH contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 68 | 1 | 1 |
| α-helix | 70-79 | 10 | |
| β-strand | 82-84 | 3 | 2 |
| α-helix | 90-101 | 12 | |
| β-strand | 109-111 | 3 | 3 |
| β-strand | 114-115 | 2 | 4 |
| β-strand | 124-125 | 2 | 4 |
| β-strand | 136 | 1 | 3 |
| β-strand | 153-156 | 4 | 3 |
| β-strand | 163-165 | 3 | 3 |
| β-strand | 172 | 1 | 1 |
| β-strand | 176-178 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tetranectin | A | protein | 118 | Homo sapiens | P05452 (AlphaFold model) |
>1RJH_1 Tetranectin (chains A) FTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTW VDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV
Structure of the Plasminogen Kringle 4 Binding Calcium-Free Form of the C-Type Lectin-Like Domain of Tetranectin. Nielbo, S., Thomsen, J.K., Graversen, J.H. et al. Biochemistry (2004) 43:8636-8643. DOI 10.1021/bi049570s · PubMed
Other PDB entries of the same protein (UniProt P05452 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RJH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.