1HXS: Mahoney strain of poliovirus

Name: PDB 1HXS: Crystal structure of mahoney strain of poliovirus at 2.2A resolution
Published: 2002-01-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: virus

Crystal structure of mahoney strain of poliovirus at 2.2A resolution. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Jan 2002.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Human poliovirus 1
Chains: 4
Atoms: 7,256
Mol. weight: 97.71 kDa
Ligands: MYR, PLM
Released: 16 Jan 2002

Explore 1HXS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HXS contains 40 α-helices and 68 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 1: 16 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	7-9	3	1
β-strand	22	1	2
β-strand	26	1	3
α-helix	27-29	3
β-strand	30	1	4
α-helix	31-32	2
β-strand	33	1	5
β-strand	44-45	2	6
α-helix	47-49	3
α-helix	51-53	3
α-helix	57-59	3
β-strand	63	1	5
β-strand	66	1	4
β-strand	71	1	3
α-helix	73-75	3
β-strand	76	1	7
α-helix	77-81	5
β-strand	85-94	10	8
α-helix	102-103	2
β-strand	106-109	4	9
α-helix	117-122	6
β-strand	125-142	18	8
β-strand	154-160	7	9
α-helix	165-167	3
α-helix	173-176	4
β-strand	182-186	5	9
β-strand	192-196	5	8
β-strand	205-206	2	8
β-strand	211	1	10
α-helix	215-216	2
β-strand	217	1	11
α-helix	233-235	3
β-strand	239-244	6	9
α-helix	247-248	2
β-strand	253-271	19	8
α-helix	273-274	2
β-strand	275	1	12
α-helix	294-296	3
β-strand	297	1	13

Chain 2: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	14-18	5	14
β-strand	21-25	5	14
β-strand	32-33	2	15
α-helix	34-36	3
α-helix	44-46	3
α-helix	52-53	2
β-strand	54	1	15
α-helix	57-59	3
β-strand	64-65	2	15
α-helix	66-68	3
β-strand	69-72	4	16
β-strand	78-82	5	17
α-helix	84-86	3
α-helix	90-98	9
β-strand	99-111	13	15
β-strand	118-128	11	17
β-strand	134	1	18
α-helix	145-148	4
α-helix	151-153	3
β-strand	155-156	2	17
β-strand	158	1	19
β-strand	174	1	18
β-strand	177	1	19
α-helix	178-180	3
β-strand	185	1	12
α-helix	187-192	6
β-strand	195-199	5	17
β-strand	205-210	6	15
β-strand	219	1	15
β-strand	224	1	10
β-strand	227-239	13	17
β-strand	246-249	4	16
β-strand	250-263	14	15
α-helix	266-267	2
β-strand	269	1	11

Chain 3: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	23	1	8
α-helix	30-33	4
β-strand	39-40	2	8
β-strand	42	1	7
α-helix	43-47	5
β-strand	51-52	2	6
β-strand	57	1	13
α-helix	65-68	4
β-strand	70-73	4	6
α-helix	75-77	3
β-strand	83-86	4	20
α-helix	99-104	6
β-strand	107-111	5	21
β-strand	114-120	7	6
β-strand	127	1	22
β-strand	129-135	7	20
α-helix	140-142	3
α-helix	145-148	4
β-strand	152-157	6	20
α-helix	158	1
β-strand	163-168	6	6
β-strand	177-178	2	21
β-strand	189-194	6	20
β-strand	199	1	22
β-strand	207-216	10	6
β-strand	221-225	5	21

Chain 4: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	26-29	4	1
α-helix	36-38	3
α-helix	40-41	2
β-strand	46	1	2
α-helix	51-54	4
β-strand	57	1	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Genome polyprotein, coat protein VP1	1	protein	302	Human poliovirus 1	P03300 (AlphaFold model)
Genome polyprotein, coat protein VP2	2	protein	272	Human poliovirus 1	P03300 (AlphaFold model)
Genome polyprotein, coat protein VP3	3	protein	237	Human poliovirus 1	P03300 (AlphaFold model)
Genome polyprotein, coat protein VP4	4	protein	68	Human poliovirus 1	P03300 (AlphaFold model)

Sequence of entity 1 (1), FASTA

>1HXS_1 GENOME POLYPROTEIN, COAT PROTEIN VP1 (chains 1)
GLGQMGSSSTDNTVRETVGAATSRDALPNTEASGPTHSKEIPALTAVETGATNPLVPSDT
VQTRHVVQHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRR
KLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSN
PSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGIL
AVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLT
TY

Sequence of entity 2 (2), FASTA

>1HXS_2 GENOME POLYPROTEIN, COAT PROTEIN VP2 (chains 2)
SPNIEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEYLRDSEANPVDQPTEPDVAA
CRFYTLDTVSWTKESRGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQG
ALGVFAVPEMCLAGDSNTTTMHTSYQNANPGEKGGTFTGTFTPDNNQTSPARRFCPVDYL
LGNGTLLGNAFVFPHQIINLRTNNCATLVLPYVNSLSIDSMVKHNNWGIAILPLAPLNFA
SESSPEIPITLTIAPMCCEFNGLRNITLPRLQ

Sequence of entity 3 (3), FASTA

>1HXS_3 GENOME POLYPROTEIN, COAT PROTEIN VP3 (chains 3)
GLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDTMIPFDLSAT
KKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTHWAGSLKFTFLF
CGSMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTI
DDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLLRDTTHIEQKALA

Sequence of entity 4 (4), FASTA

>1HXS_4 GENOME POLYPROTEIN, COAT PROTEIN VP4 (chains 4)
GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVL
IKTAPMLN

Ligands and cofactors

ID	Name	Formula	Copies
MYR	Myristic acid	C14 H28 O2	1
PLM	Palmitic acid	C16 H32 O2	1

Primary citation

Ab initio phasing of high-symmetry macromolecular complexes: successful phasing of authentic poliovirus data to 3.0 A resolution. Miller, S.T., Hogle, J.M., Filman, D.J. J Mol Biol (2001) 307:499-512. DOI 10.1006/jmbi.2001.4485 · PubMed

Other PDB entries of the same protein (UniProt P03300 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DCD 1.69 Å, 1.6A resolution structure of PolioVirus 3C Protease Containing a covalently bound…
9U04 1.7 Å, LX-2D6 (Fab) - Polio 1 (VLP) complex
1RA6 2.0 Å, Poliovirus Polymerase Full Length Apo Structure
4NLR 2.0 Å, Poliovirus Polymerase - C290S Loop Mutant
4NLS 2.0 Å, Poliovirus Polymerase - S288A Loop Mutant
1L1N 2.1 Å, Poliovirus 3C proteinase
4NLU 2.1 Å, Poliovirus Polymerase - G289A Loop Mutant
4NLW 2.1 Å, Poliovirus Polymerase - G289A/C290I Loop Mutant
4NLO 2.2 Å, Poliovirus Polymerase - C290I Loop Mutant
4NLP 2.2 Å, Poliovirus Polymerase - C290V Loop Mutant
2IM0 2.25 Å, Crystal structure of poliovirus polymerase complexed with CTP and Mg2+
1TQL 2.3 Å, Poliovirus polymerase G1A mutant

Browse structure collections

About this viewer

MolViewer shows 1HXS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.