1I4M: Major prion protein

Crystal structure of the human prion protein reveals a mechanism for oligomerization. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Feb 2002.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,005
Mol. weight: 12.98 kDa
Ligands: CD
Released: 27 Feb 2002

Explore 1I4M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I4M contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	129-130	2	1
α-helix	131-133	3
α-helix	135-138	4
α-helix	144-153	10
α-helix	154-156	3
β-strand	162-163	2	1
α-helix	166-168	3
α-helix	172-189	18
α-helix	194-197	4
α-helix	200-223	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Major prion protein	A	protein	108	Homo sapiens	P04156 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1I4M_1 MAJOR PRION PROTEIN (chains A)
GAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHD
CVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYY

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Crystal structure of the human prion protein reveals a mechanism for oligomerization. Knaus, K.J., Morillas, M., Swietnicki, W. et al. Nat Struct Biol (2001) 8:770-774. DOI 10.1038/nsb0901-770 · PubMed

Other PDB entries of the same protein (UniProt P04156 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OL9 0.85 Å, Peptide corresponding to residues 170-175 of human prion
7RVE 0.85 Å, Segment from the S170N mutant of the human prion protein 168-176 EYNNQNNFV
7RVJ 1.0 Å, Segment from the human prion protein 169-175 YSNQNNF
7RVK 1.0 Å, Segment from Y169G mutant of the human prion protein 169-175 GSNQNNF
7RVL 1.0 Å, Segment from the Y169F mutant of the human prion protein 168-176 EFSNQNNFV
7RVC 1.0 Å, Segment from the human prion protein 168-176 EYSNQNNFV
3MD4 1.15 Å, Prion peptide
3MD5 1.4 Å, Prion peptide
4E1H 1.4 Å, Fragment of human prion protein
6PQA 1.46 Å, GAVVGG segment 119-124 from human prion
4KML 1.5 Å, Probing the N-terminal beta-sheet conversion in the crystal structure of the full-length…
4N9O 1.5 Å, Probing the N-terminal beta-sheet conversion in the crystal structure of the human prion…

Browse structure collections

About this viewer

MolViewer shows 1I4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.