1I7X: Beta-catenin/e-cadherin complex

Beta-catenin/e-cadherin complex. Determined by X-ray diffraction at 3.0 Å resolution. Released 16 May 2001.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Mus musculus
Chains: 4
Atoms: 8,930
Mol. weight: 151.7 kDa
Released: 16 May 2001

Explore 1I7X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I7X contains 84 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	142-150	9
α-helix	153-161	9
α-helix	165-180	16
α-helix	182-188	7
α-helix	192-204	13
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-243	8
α-helix	249-265	17
α-helix	269-276	8
α-helix	278-285	8
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-348	15
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-388	14
α-helix	389-392	4
α-helix	399-408	10
α-helix	414-427	14
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	490-496	7
α-helix	504-517	14
α-helix	521-523	3
α-helix	524-528	5
α-helix	532-549	18
β-strand	561	1	1
β-strand	564	1	1
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-603	8
α-helix	608-621	14
α-helix	625-634	10
α-helix	637-642	6
α-helix	643-645	3
α-helix	649-663	15

Chain B: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	630-633	4	2
α-helix	650-652	3
α-helix	653-666	14
α-helix	672-673	2
β-strand	674-677	4	2

Chain C: 37 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	137-160	24
α-helix	165-178	14
α-helix	182-189	8
α-helix	192-204	13
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-243	8
α-helix	249-265	17
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-348	15
α-helix	353-360	8
α-helix	362-367	6
α-helix	375-389	15
α-helix	399-408	10
α-helix	414-427	14
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	490-496	7
α-helix	504-518	15
α-helix	521-523	3
α-helix	524-529	6
α-helix	532-546	15
β-strand	561	1	3
β-strand	564	1	3
α-helix	566-580	15
α-helix	584-591	8
α-helix	596-599	4
α-helix	600-603	4
α-helix	608-621	14
α-helix	625-632	8
α-helix	637-642	6
α-helix	649-662	14

Chain D: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	632-633	2	4
α-helix	656-658	3
α-helix	662-665	4
α-helix	673	1
β-strand	674-675	2	4
α-helix	706-708	3
α-helix	713-715	3
α-helix	716-722	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-catenin	A, C	protein	538	Mus musculus	Q02248 (AlphaFold model)
Epithelial-cadherin	B, D	protein	151	Mus musculus	P09803 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1I7X_1 BETA-CATENIN (chains A, C)
HAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQ
MVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLF
YAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKL
IILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP
SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYK
NKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPV
VVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSM
GGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRV
AAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYK

Sequence of entity 2 (B, D), FASTA

>1I7X_2 EPITHELIAL-CADHERIN (chains B, D)
RRRTVVKEPLLPPDDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTL
MSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSGSEAASLSSLNSS
ESDQDQDYDYLNEWGNRFKKLADMYGGGEDD

Primary citation

The structure of the beta-catenin/E-cadherin complex and the molecular basis of diverse ligand recognition by beta-catenin. Huber, A.H., Weis, W.I. Cell (2001) 105:391-402. DOI 10.1016/S0092-8674(01)00330-0 · PubMed

Other PDB entries of the same protein (UniProt Q02248 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DOW 1.8 Å, Crystal structure of a chimera of beta-catenin and alpha-catenin
4EV8 1.9 Å, Crystal structure of mouse catenin beta-59 in 2.4M urea.
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
4EVA 2.0 Å, Crystal Structure of Mouse Catenin beta-59 in 5.6M urea
1M1E 2.1 Å, Beta-catenin armadillo repeat domain bound to ICAT
1V18 2.1 Å, The crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated…
3BCT 2.1 Å, The armadillo repeat region from murine beta-catenin
4EV9 2.1 Å, Crystal Structure of Mouse Catenin beta-59 in 4.0M urea
4EVP 2.25 Å, Crystal Structure of Mouse Catenin beta-59 in 7.2M urea
4EVT 2.34 Å, Crystal Structure of Mouse Catenin beta-59 in 8.3M urea
3OUX 2.4 Å, Structure of beta-catenin with phosphorylated Lef-1
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…

Browse structure collections

About this viewer

MolViewer shows 1I7X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.