1I8V: RNase sa Y80F mutant

Crystal structure of RNase sa Y80F mutant. Determined by X-ray diffraction at 1.25 Å resolution. Released 19 Sept 2001.

Method: X-ray diffraction
Resolution: 1.25 Å
Organism: Streptomyces aureofaciens
Chains: 2
Atoms: 1,805
Mol. weight: 21.33 kDa
Released: 19 Sept 2001

Explore 1I8V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1I8V contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
α-helix	8-10	3
α-helix	13-23	11
α-helix	35	1
β-strand	36	1	1
α-helix	37	1
α-helix	45-46	2
β-strand	53-56	4	1
α-helix	58-59	2
β-strand	69-72	4	1
β-strand	79-82	4	1
β-strand	90-93	4	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	2
α-helix	8-10	3
α-helix	13-24	12
β-strand	35-36	2	2
α-helix	37	1
α-helix	45-46	2
β-strand	53-56	4	2
β-strand	69-72	4	2
β-strand	79-82	4	2
β-strand	90-93	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Guanyl-specific ribonuclease sa	A, B	protein	96	Streptomyces aureofaciens	P05798 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1I8V_1 GUANYL-SPECIFIC RIBONUCLEASE SA (chains A, B)
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITP
GARTRGTRRIITGEATQEDFYTGDHYATFSLIDQTC

Primary citation

Tyrosine hydrogen bonds make a large contribution to protein stability. Pace, C.N., Horn, G., Hebert, E.J. et al. J Mol Biol (2001) 312:393-404. DOI 10.1006/jmbi.2001.4956 · PubMed

Other PDB entries of the same protein (UniProt P05798 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LNI 1.0 Å, Crystal structure analysis of a ribonuclease from streptomyces aureofaciens at atomic…
1T2H 1.0 Å, Y81W mutant of RNase Sa from Streptomyces aureofaciens
1T2I 1.1 Å, T76W mutant of RNase Sa from Streptomyces aureofaciens
4GHO 1.1 Å, Crystal Structure Analysis of Streptomyces aureofaciens Ribonuclease S24A mutant
1ZGX 1.13 Å, Crystal structure of ribonuclease mutant
1RGE 1.15 Å, Hydrolase, guanyloribonuclease
1RGF 1.2 Å, Hydrolase, guanyloribonuclease
1RGG 1.2 Å, Hydrolase, guanyloribonuclease
1RGH 1.2 Å, Hydrolase, guanyloribonuclease
1YNV 1.2 Å, Asp79 makes a large, unfavorable contribution to the stability of RNase Sa
4J5K 1.23 Å, Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa Y51F mutant
4J5G 1.31 Å, Crystal structure analysis of Streptomyces aureofaciens ribonuclease Sa T95A mutant

Browse structure collections

About this viewer

MolViewer shows 1I8V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.