1I9W: Fusion glycoprotein E1 from semliki forest virus

Crystal structure of the fusion glycoprotein E1 from semliki forest virus. Determined by X-ray diffraction at 3.0 Å resolution. Released 6 Apr 2002.

Method

X-ray diffraction

Resolution

3.0 Å

Organism

Semliki forest virus

Chains

1

Atoms

369

Mol. weight

42.62 kDa

Released

6 Apr 2002

Explore 1I9W in 3D Show helices and sheets RCSB PDB PDBe

Molecules and chains

>1I9W_1 FUSION PROTEIN E1 (chains A)
YEHSTVMPNVVGFPYKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYV
KCCGASECSTKEKPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHDHAS
AYKAHTASLKAKVRVMYGNVNQTVDVYVNGDHAVTIGGTQFIFGPLSSAWTPFDNKIVVY
KDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGF
KYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLT
CTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTAS
ASPSFVVSLCSARATCSASCEPPKDHIVPY

Primary citation

The Fusion glycoprotein shell of Semliki Forest virus: an icosahedral assembly primed for fusogenic activation at endosomal pH. Lescar, J., Roussel, A., Wien, M.W. et al. Cell (2001) 105:137-148. DOI 10.1016/S0092-8674(01)00303-8 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P03315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 2V33 1.55 Å, High resolution crystal structure of domain III of E1 fusion glycoprotein of Semliki…
• 1VCP 3.0 Å, Semliki forest virus capsid protein (crystal form I)
• 2ALA 3.0 Å, Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric…
• 8IHP 3.0 Å, Structure of Semliki Forest virus VLP in complex with the receptor VLDLR-LA3
• 8YVY 3.02 Å, Semliki Forest virus virion
• 1VCQ 3.1 Å, Semliki forest virus capsid protein (crystal form II)
• 1RER 3.2 Å, Crystal structure of the homotrimer of fusion glycoprotein E1 from Semliki Forest Virus.
• 8YW1 3.44 Å, Semliki Forest virus viron in complex with VLDLR
• 8YVZ 3.45 Å, Semliki Forest virus viron
• 8X0K 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(2-fold)
• 8X0L 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(3-fold)
• 8X0M 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(5-fold)

Browse structure collections

About this viewer

MolViewer shows 1I9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.