2ALA: Structural polyprotein

Crystal structure of the Semliki Forest Virus envelope protein E1 in its monomeric conformation. Determined by X-ray diffraction at 3.0 Å resolution. Released 17 Jan 2006.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Semliki forest virus
Chains: 1
Atoms: 3,023
Mol. weight: 42.69 kDa
Released: 17 Jan 2006

Explore 2ALA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ALA contains 8 α-helices and 36 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	2-3	2	1
β-strand	6-8	3	2
β-strand	11	1	3
β-strand	15-17	3	3
β-strand	29-48	20	3
β-strand	51-54	4	4
α-helix	56-58	3
β-strand	59-61	3	5
β-strand	77-82	6	5
α-helix	88-92	5
β-strand	101-106	6	5
β-strand	107-110	4	4
β-strand	119-136	18	3
β-strand	143-147	5	3
β-strand	154-156	3	1
β-strand	159-163	5	1
β-strand	176-179	4	3
β-strand	184-186	3	3
α-helix	189-191	3
β-strand	203-204	2	6
β-strand	205	1	3
β-strand	214-215	2	6
β-strand	220-221	2	7
β-strand	233-234	2	7
α-helix	239-246	8
α-helix	251-253	3
α-helix	256-258	3
β-strand	260-262	3	3
β-strand	267-269	3	3
β-strand	275-277	3	2
β-strand	278-281	4	1
α-helix	284-286	3
α-helix	294-295	2
β-strand	296-305	10	8
β-strand	307	1	9
β-strand	314-322	9	8
β-strand	326-328	3	10
β-strand	331-332	2	11
β-strand	337-339	3	8
β-strand	344-346	3	10
β-strand	352-358	7	8
β-strand	364-369	6	11
β-strand	372-377	6	11
β-strand	381	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Structural polyprotein (P130)	A	protein	391	Semliki forest virus	P03315 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ALA_1 Structural polyprotein (P130) (chains A)
YEHSTVMPNVVGFPYKAHIERPGYSPLTLQMQVVETSLEPTLNLEYITCEYKTVVPSPYV
KCCGASECSTKEKPDYQCKVYTGVYPFMWGGAYCFCDSENTQLSEAYVDRSDVCRHDHAS
AYKAHTASLKAKVRVMYGNVNQTVDVYVNGDHAVTIGGTQFIFGPLSSAWTPFDNKIVVY
KDEVFNQDFPPYGSGQPGRFGDIQSRTVESNDLYANTALKLARPSPGMVHVPYTQTPSGF
KYWLKEKGTALNTKAPFGCQIKTNPVRAMNCAVGNIPVSMNLPDSAFTRIVEAPTIIDLT
CTVATCTHSSDFGGVLTLTYKTNKNGDCSVHSHSNVATLQEATAKVKTAGKVTLHFSTAS
ASPSFVVSLCSARATCSASCEPPKDHIVPYA

Primary citation

Structure and interactions at the viral surface of the envelope protein E1 of Semliki Forest virus. Roussel, A., Lescar, J., Vaney, M.C. et al. Structure (2006) 14:75-86. DOI 10.1016/j.str.2005.09.014 · PubMed

Other PDB entries of the same protein (UniProt P03315 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2V33 1.55 Å, High resolution crystal structure of domain III of E1 fusion glycoprotein of Semliki…
1I9W 3.0 Å, Crystal structure of the fusion glycoprotein E1 from semliki forest virus
1VCP 3.0 Å, Semliki forest virus capsid protein (crystal form I)
8IHP 3.0 Å, Structure of Semliki Forest virus VLP in complex with the receptor VLDLR-LA3
8YVY 3.02 Å, Semliki Forest virus virion
1VCQ 3.1 Å, Semliki forest virus capsid protein (crystal form II)
1RER 3.2 Å, Crystal structure of the homotrimer of fusion glycoprotein E1 from Semliki Forest Virus.
8YW1 3.44 Å, Semliki Forest virus viron in complex with VLDLR
8YVZ 3.45 Å, Semliki Forest virus viron
8X0K 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(2-fold)
8X0L 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(3-fold)
8X0M 3.5 Å, Cryo-EM structure of Semliki Forest virus in complex with its receptor VLDLR(5-fold)

Browse structure collections

About this viewer

MolViewer shows 2ALA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.