1IC1: Intercellular adhesion molecule-1

The crystal structure for the N-terminal two domains of icam-1. Determined by X-ray diffraction at 3.0 Å resolution. Released 17 Jun 1998.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,131
Mol. weight: 44.22 kDa
Ligands: NAG
Released: 17 Jun 1998

Explore 1IC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IC1 contains 9 α-helices and 49 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	8-12	5	2
β-strand	14	1	3
β-strand	17-22	6	1
β-strand	30-34	5	4
β-strand	41	1	1
β-strand	49-54	6	1
β-strand	57	1	3
β-strand	61	1	2
β-strand	64-68	5	4
β-strand	74-77	4	4
β-strand	79-83	5	2
β-strand	84	1	5
β-strand	88-91	4	6
α-helix	92-93	2
β-strand	97-99	3	7
β-strand	103-111	9	6
β-strand	114	1	5
α-helix	116-118	3
β-strand	119-125	7	8
β-strand	128-134	7	8
β-strand	137	1	6
β-strand	140-147	8	6
α-helix	150-152	3
β-strand	156-164	9	8
β-strand	172-176	5	8
α-helix	177-179	3
β-strand	180-181	2	8
α-helix	182	1
β-strand	183-185	3	7

Chain B: 4 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	9
β-strand	8-12	5	10
α-helix	15-16	2
β-strand	17-23	7	9
β-strand	30-33	4	11
β-strand	39-42	4	9
β-strand	49-54	6	9
β-strand	61	1	10
β-strand	64-70	7	11
β-strand	72-77	6	11
β-strand	79-83	5	10
β-strand	84	1	12
β-strand	88-91	4	13
α-helix	92-93	2
β-strand	97-99	3	14
β-strand	103-111	9	13
β-strand	114	1	12
α-helix	116-118	3
β-strand	119-125	7	15
β-strand	128-129	2	15
β-strand	133-134	2	15
β-strand	137	1	13
β-strand	140-147	8	13
β-strand	155-164	10	15
β-strand	172-176	5	15
α-helix	177-179	3
β-strand	180-182	3	15
β-strand	183-185	3	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Intercellular adhesion molecule-1	A, B	protein	190	Homo sapiens	P05362 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1IC1_1 INTERCELLULAR ADHESION MOLECULE-1 (chains A, B)
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQED
SQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLT
VVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPY
QLQTFVLPAT

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

A dimeric crystal structure for the N-terminal two domains of intercellular adhesion molecule-1. Casasnovas, J.M., Stehle, T., Liu, J.H. et al. Proc Natl Acad Sci U S A (1998) 95:4134-4139. DOI 10.1073/pnas.95.8.4134 · PubMed

Other PDB entries of the same protein (UniProt P05362 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IAM 2.1 Å, Structure of the two amino-terminal domains of human intercellular adhesion molecule-1,…
7BG7 2.4 Å, HRV14 in complex with its receptor ICAM-1
2OZ4 2.7 Å, Structural Plasticity in IgSF Domain 4 of ICAM-1 Mediates Cell Surface Dimerization
5MZA 2.78 Å, The DBLb domain of PF11_0521 PfEMP1 bound to human ICAM-1
1P53 3.06 Å, The Crystal Structure of ICAM-1 D3-D5 fragment
1D3L 3.25 Å, D1D2-icam-1 fully glycosylated, variation of D1-D2 interdomain angle in different…
1MQ8 3.3 Å, Crystal structure of alphaL I domain in complex with ICAM-1
3TCX 3.6 Å, Structure of Engineered Single Domain ICAM-1 D1 with High-Affinity aL Integrin I Domain…
6S8U 3.67 Å, Structure of the PfEMP1 IT4var13 DBLbeta domain bound to ICAM-1
6EIT 3.9 Å, Coxsackievirus A24v in complex with the D1-D2 fragment of ICAM-1
1Z7Z 8.0 Å, Cryo-em structure of human coxsackievirus A21 complexed with five domain icam-1kilifi
1D3I 26.0 Å, cryo-EM structure of human rhinovirus 14 (HRV14) complexed with a two-domain fragment of…

Browse structure collections

About this viewer

MolViewer shows 1IC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.