1IGL: Insulin-like growth factor II

Name: PDB 1IGL: Solution structure of human insulin-like growth factor II relationship to receptor and binding protein interactions
Published: 1995-02-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: growth factor

Solution structure of human insulin-like growth factor II relationship to receptor and binding protein interactions. Determined by solution NMR. Released 14 Feb 1995.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 521
Mol. weight: 7.48 kDa
Released: 14 Feb 1995

Explore 1IGL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IGL contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-20	7
β-strand	26	1	1
α-helix	44-48	5
α-helix	54-59	6
β-strand	60	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-like growth factor II	A	protein	67	Homo sapiens	P01344 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IGL_1 INSULIN-LIKE GROWTH FACTOR II (chains A)
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYC
ATPAKSE

Primary citation

Solution structure of human insulin-like growth factor II. Relationship to receptor and binding protein interactions. Torres, A.M., Forbes, B.E., Aplin, S.E. et al. J Mol Biol (1995) 248:385-401. PubMed

Other PDB entries of the same protein (UniProt P01344 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KR3 2.2 Å, Crystal structure of IGF-II antibody complex
3E4Z 2.28 Å, Crystal structure of human insulin degrading enzyme in complex with insulin-like growth…
6VWG 3.21 Å, Head region of the open conformation of the human type 1 insulin-like growth factor…
8YSZ 3.38 Å, Cryo-EM structure of the complex IR with three IGF-II
8U4C 3.6 Å, Cryo-EM structure of long form insulin receptor (IR-B) with four IGF2 bound, symmetric…
8VJB 3.6 Å, Cryo-EM structure of short form insulin receptor (IR-A) with four IGF2 bound, symmetric…
6VWI 3.7 Å, Head region of the closed conformation of the human type 1 insulin-like growth factor…
8VJC 3.8 Å, Cryo-EM structure of short form insulin receptor (IR-A) with three IGF2 bound,…
2V5P 4.1 Å, Complex structure of human IGF2R domains 11-13 bound to igf-II
8U4E 4.2 Å, Cryo-EM structure of long form insulin receptor (IR-B) with three IGF2 bound, asymmetric…
6UM2 4.32 Å, Structure of M-6-P/IGFII Receptor and IGFII complex
2L29 Complex structure of E4 mutant human IGF2R domain 11 bound to IGF-II

Browse structure collections

About this viewer

MolViewer shows 1IGL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.