1IGY: Immunoglobulin

Name: PDB 1IGY: Structure of immunoglobulin
Published: 1998-04-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: immunoglobulin

Structure of immunoglobulin. Determined by X-ray diffraction at 3.2 Å resolution. Released 15 Apr 1998.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Mus musculus
Chains: 4
Atoms: 10,252
Mol. weight: 146.1 kDa
Released: 15 Apr 1998

Explore 1IGY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IGY contains 34 α-helices and 151 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	10-13	4	2
β-strand	18-20	3	1
β-strand	23-25	3	1
β-strand	33	1	3
β-strand	35-38	4	2
β-strand	45-48	4	2
β-strand	54	1	2
α-helix	55	1
β-strand	62-66	5	1
β-strand	70-76	7	1
α-helix	80-82	3
β-strand	84-87	4	2
β-strand	89	1	4
β-strand	90	1	3
α-helix	96	1
β-strand	97	1	5
β-strand	98	1	4
β-strand	102-106	5	2
α-helix	107	1
β-strand	111	1	6
β-strand	114-118	5	7
α-helix	122-125	4
β-strand	130-132	3	8
β-strand	133-137	5	7
β-strand	139	1	9
β-strand	140	1	6
β-strand	145-149	5	10
β-strand	159-160	2	8
β-strand	173	1	9
β-strand	178-181	4	8
α-helix	183-187	5
β-strand	191	1	11
β-strand	193-197	5	10
β-strand	205	1	10
β-strand	210	1	11

Chain B: 11 helices, 46 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	12
β-strand	11-12	2	13
β-strand	15	1	14
β-strand	18-20	3	15
β-strand	23-24	2	12
α-helix	29-31	3
β-strand	35-39	5	5
β-strand	45-50	6	5
α-helix	61-63	3
β-strand	67-68	2	15
β-strand	71	1	16
α-helix	73-75	3
β-strand	77	1	12
β-strand	78	1	16
β-strand	80-82	3	15
β-strand	82C	1	14
α-helix	84-86	3
β-strand	89-90	2	5
β-strand	107-108	2	5
β-strand	110-111	2	13
β-strand	117	1	17
β-strand	121-124	4	18
β-strand	137-147	11	18
β-strand	148	1	17
β-strand	153-157	4	19
β-strand	166	1	19
β-strand	171-173	3	18
β-strand	177-178	2	18
β-strand	185-194	10	18
β-strand	207-211	5	19
β-strand	219-222	4	19
β-strand	253-256	4	20
α-helix	257-259	3
α-helix	260-264	5
β-strand	271-272	2	21
β-strand	273-276	4	20
β-strand	288	1	22
β-strand	290	1	23
β-strand	291	1	24
β-strand	301	1	23
β-strand	325-326	2	21
α-helix	329-334	6
β-strand	339	1	24
β-strand	342	1	22
β-strand	365	1	25
β-strand	370-372	3	26
α-helix	373-375	3
β-strand	385-395	11	26
β-strand	396	1	25
β-strand	400-408	7	27
β-strand	420-421	2	26
α-helix	422-424	3
β-strand	435-444	10	26
α-helix	445-449	5
β-strand	454-460	7	27
α-helix	464-466	3
β-strand	468-472	5	27

Chain C: 6 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	28
β-strand	10-13	4	29
β-strand	18-20	3	28
β-strand	23-25	3	28
β-strand	33	1	30
β-strand	36-38	3	29
β-strand	45-46	2	29
β-strand	48	1	31
β-strand	54	1	31
α-helix	55	1
β-strand	62-66	5	28
β-strand	70-76	7	28
α-helix	80-82	3
β-strand	84-87	4	29
β-strand	89	1	32
β-strand	90	1	30
α-helix	96	1
β-strand	97	1	33
β-strand	98	1	32
β-strand	102-106	5	29
α-helix	107	1
β-strand	111	1	34
β-strand	114-118	5	35
α-helix	122-125	4
β-strand	130-132	3	36
β-strand	133-137	5	35
β-strand	139	1	37
β-strand	140	1	34
β-strand	145-149	5	38
β-strand	159-160	2	36
β-strand	173	1	37
β-strand	178-181	4	36
α-helix	183-187	5
β-strand	193-197	5	38
β-strand	205	1	38

Chain D: 11 helices, 46 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	39
β-strand	11-12	2	40
β-strand	15	1	41
β-strand	18-20	3	42
β-strand	23-24	2	39
β-strand	35-39	5	33
β-strand	45-50	6	33
α-helix	61-63	3
β-strand	67-68	2	42
β-strand	71	1	43
α-helix	73-75	3
β-strand	77	1	39
β-strand	78	1	43
β-strand	80-82	3	42
β-strand	82C	1	41
α-helix	84-86	3
β-strand	88-90	3	33
β-strand	107-109	3	33
β-strand	110-111	2	40
β-strand	117	1	44
β-strand	120-124	5	45
β-strand	137-147	11	45
β-strand	148	1	44
β-strand	153-157	4	46
β-strand	166	1	46
β-strand	171-173	3	45
β-strand	177-178	2	45
β-strand	185-194	10	45
β-strand	207-211	5	46
β-strand	219-222	4	46
α-helix	226-229	4
β-strand	253-256	4	47
α-helix	257-259	3
α-helix	260-264	5
β-strand	271-272	2	48
β-strand	273-276	4	47
β-strand	288	1	49
β-strand	290	1	50
β-strand	291	1	51
β-strand	301	1	50
β-strand	325-326	2	48
α-helix	329-334	6
β-strand	339	1	51
β-strand	342	1	49
β-strand	365	1	52
β-strand	370-372	3	53
α-helix	373-375	3
β-strand	385-395	11	53
β-strand	396	1	52
β-strand	400-408	7	54
β-strand	420-421	2	53
α-helix	422-424	3
β-strand	435-444	10	53
α-helix	445-449	5
β-strand	454-460	7	54
α-helix	464-466	3
β-strand	468-472	5	54

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
IgG1 intact antibody MAB61.1.3	A, C	protein	213	Mus musculus	P01837 (AlphaFold model)
IgG1 intact antibody MAB61.1.3	B, D	protein	434	Mus musculus	P01869 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1IGY_1 IGG1 INTACT ANTIBODY MAB61.1.3 (chains A, C)
KCAHTVSKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDR
FTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B, D), FASTA

>1IGY_2 IGG1 INTACT ANTIBODY MAB61.1.3 (chains B, D)
VKLQESGAELARPGASVKMSCKASGYTFTTYTIHWIKQRPGQGLEWIGYINPSSVYTNYN
QRFKDKATLTRDRSSNTANIHLSSLTSDDSAVYYCVREGEVPYWGQGTTVTVSSAKTTPP
SVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSS
SVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKD
TLLITVTPKVTCVVVDISKDDPEVQFSWFVDNVEVHTAQTQPREEQFNSTFRVVSALPIM
HQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGKPRAPQVYTIPPPKEQMAKDKVSLTCMI
TDFFPEDITVEWQSDGQAPENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLH
EGLHNHHTEKSLSH

Primary citation

Crystallographic structure of an intact IgG1 monoclonal antibody. Harris, L.J., Skaletsky, E., McPherson, A. J Mol Biol (1998) 275:861-872. DOI 10.1006/jmbi.1997.1508 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse more

1IGY is part of these collections:

Antibodies and the immune system

About this viewer

MolViewer shows 1IGY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.