1IGZ: Prostaglandin Endoperoxide H Synthase-1

Crystal Structure of Linoleic acid Bound in the Cyclooxygenase Channel of Prostaglandin Endoperoxide H Synthase-1. Determined by X-ray diffraction at 2.9 Å resolution. Released 12 Dec 2001.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Ovis aries
Chains: 1
Atoms: 4,705
Mol. weight: 69.59 kDa
Ligands: EIC, COH, BOG, BGC
Released: 12 Dec 2001

Explore 1IGZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IGZ contains 37 α-helices and 33 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	35-37	3
α-helix	45	1
β-strand	46-50	5	1
β-strand	54-58	5	1
β-strand	64-65	2	2
β-strand	71-72	2	2
α-helix	74-82	9
α-helix	83-85	3
α-helix	86-93	8
α-helix	99-105	7
α-helix	108-121	14
β-strand	130-131	2	3
α-helix	139-143	5
β-strand	147	1	4
β-strand	149-150	2	3
β-strand	154	1	5
β-strand	161	1	6
β-strand	164	1	6
α-helix	174-177	4
α-helix	178-182	5
β-strand	183	1	7
β-strand	189	1	8
β-strand	194	1	9
β-strand	195	1	10
α-helix	196-206	11
β-strand	212	1	11
β-strand	220	1	4
β-strand	221	1	11
α-helix	238-244	7
β-strand	245	1	12
β-strand	252	1	12
β-strand	255-257	3	13
β-strand	260-262	3	13
α-helix	263-264	2
β-strand	265	1	14
β-strand	285	1	14
α-helix	296-319	24
α-helix	325-343	19
α-helix	344-349	6
α-helix	350-353	4
α-helix	363-366	4
β-strand	378	1	3
α-helix	379-384	6
α-helix	388-390	3
β-strand	395-397	3	15
β-strand	400-402	3	15
α-helix	404-407	4
α-helix	413-417	5
α-helix	419-426	8
β-strand	430	1	10
β-strand	432	1	8
β-strand	440	1	7
α-helix	445-458	14
β-strand	460	1	5
α-helix	461-462	2
α-helix	463-469	7
α-helix	473-475	3
α-helix	478-481	4
α-helix	486-495	10
α-helix	498-500	3
α-helix	503-509	7
α-helix	511	1
β-strand	512	1	16
α-helix	513	1
β-strand	519	1	16
α-helix	520-535	16
α-helix	538-540	3
α-helix	553-560	8
α-helix	564-569	6
β-strand	581	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostaglandin Endoperoxide H Synthase-1	A	protein	576	Ovis aries	P05979 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IGZ_1 Prostaglandin Endoperoxide H Synthase-1 (chains A)
ADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRP
SPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSN
VSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFLSRRFLLRRKFIPDPQGTNLMFAFFAQH
FTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPP
SVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWG
DEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQL
YHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHI
LHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFY
PGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATL
KKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL

Ligands and cofactors

ID	Name	Formula	Copies
EIC	Linoleic acid	C18 H32 O2	1
COH	Protoporphyrin IX containing co	C34 H32 Co N4 O4	1
BOG	octyl beta-D-glucopyranoside	C14 H28 O6	2
BGC	beta-D-glucopyranose	C6 H12 O6	1

Primary citation

Structure of eicosapentaenoic and linoleic acids in the cyclooxygenase site of prostaglandin endoperoxide H synthase-1. Malkowski, M.G., Thuresson, E.D., Lakkides, K.M. et al. J Biol Chem (2001) 276:37547-37555. DOI 10.1074/jbc.M105982200 · PubMed

Other PDB entries of the same protein (UniProt P05979 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Q4G 2.0 Å, 2.0 Angstrom Crystal Structure of Ovine Prostaglandin H2 Synthase-1, in complex with…
2AYL 2.0 Å, 2.0 Angstrom Crystal Structure of Manganese Protoporphyrin IX-reconstituted Ovine…
4O1Z 2.4 Å, Crystal Structure of Ovine Cyclooxygenase-1 Complex with Meloxicam
3N8Y 2.6 Å, Structure of Aspirin Acetylated Cyclooxygenase-1 in Complex with Diclofenac
1EQG 2.61 Å, The 2.6 Å model of ovine cox-1 complexed with ibuprofen
1HT8 2.69 Å, The 2.7 Å resolution model of ovine cox-1 complexed with alclofenac
1EQH 2.7 Å, The 2.7 Å model of ovine cox-1 complexed with flurbiprofen
2OYU 2.7 Å, Indomethacin-(S)-alpha-ethyl-ethanolamide bound to Cyclooxygenase-1
1HT5 2.75 Å, The 2.75 Å resolution model of ovine cox-1 complexed with methyl ester flurbiprofen
3KK6 2.75 Å, Crystal Structure of Cyclooxygenase-1 in complex with celecoxib
3N8W 2.75 Å, Crystal Structure of R120Q/Native Cyclooxygenase-1 Heterodimer mutant in complex with…
3N8X 2.75 Å, Crystal Structure of Cyclooxygenase-1 in Complex with Nimesulide

Browse structure collections

About this viewer

MolViewer shows 1IGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.