Crystal structure of SER252TRP apert mutant fgf receptor 2 (FGFR2) in complex with FGF2. Determined by X-ray diffraction at 2.7 Å resolution. Released 9 May 2001.
Explore 1II4 in 3D Show helices and sheets RCSB PDB PDBe
1II4 contains 42 α-helices and 132 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-34 | 5 | 1 |
| β-strand | 39-43 | 5 | 1 |
| β-strand | 49-52 | 4 | 1 |
| α-helix | 58-60 | 3 | |
| β-strand | 62-68 | 7 | 1 |
| β-strand | 71-76 | 6 | 1 |
| β-strand | 81-85 | 5 | 1 |
| β-strand | 91-94 | 4 | 1 |
| β-strand | 103-107 | 5 | 1 |
| β-strand | 113-117 | 5 | 1 |
| β-strand | 124 | 1 | 1 |
| β-strand | 127 | 1 | 2 |
| β-strand | 132 | 1 | 1 |
| β-strand | 133 | 1 | 2 |
| α-helix | 136-138 | 3 | |
| β-strand | 148-152 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-34 | 5 | 3 |
| β-strand | 39-43 | 5 | 3 |
| β-strand | 48-52 | 5 | 3 |
| α-helix | 58-60 | 3 | |
| β-strand | 62-68 | 7 | 3 |
| β-strand | 71-76 | 6 | 3 |
| β-strand | 81-85 | 5 | 3 |
| β-strand | 91-94 | 4 | 3 |
| β-strand | 103-107 | 5 | 3 |
| β-strand | 113-117 | 5 | 3 |
| β-strand | 124 | 1 | 3 |
| β-strand | 127 | 1 | 4 |
| β-strand | 132 | 1 | 3 |
| β-strand | 133 | 1 | 4 |
| α-helix | 136-138 | 3 | |
| β-strand | 148-152 | 5 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 152-156 | 5 | 9 |
| α-helix | 159-162 | 4 | |
| β-strand | 166-170 | 5 | 10 |
| β-strand | 175-178 | 4 | 11 |
| β-strand | 181-184 | 4 | 9 |
| β-strand | 188-193 | 6 | 10 |
| β-strand | 196-197 | 2 | 10 |
| α-helix | 200-202 | 3 | |
| β-strand | 208-210 | 3 | 11 |
| α-helix | 211-213 | 3 | |
| β-strand | 215-218 | 4 | 11 |
| α-helix | 223-225 | 3 | |
| β-strand | 227-235 | 9 | 10 |
| β-strand | 238-249 | 12 | 10 |
| β-strand | 257-258 | 2 | 12 |
| α-helix | 259 | 1 | |
| α-helix | 264-265 | 2 | |
| β-strand | 266-269 | 4 | 13 |
| β-strand | 274-277 | 4 | 14 |
| β-strand | 280-281 | 2 | 12 |
| α-helix | 285-286 | 2 | |
| β-strand | 287-293 | 7 | 13 |
| β-strand | 309-314 | 6 | 13 |
| α-helix | 321-324 | 4 | |
| β-strand | 326-329 | 4 | 14 |
| β-strand | 338-345 | 8 | 13 |
| β-strand | 350-360 | 11 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 152-156 | 5 | 21 |
| α-helix | 159-162 | 4 | |
| β-strand | 166-170 | 5 | 22 |
| β-strand | 175-178 | 4 | 23 |
| β-strand | 181-184 | 4 | 21 |
| α-helix | 186-187 | 2 | |
| β-strand | 188-193 | 6 | 22 |
| β-strand | 196-197 | 2 | 22 |
| α-helix | 200-202 | 3 | |
| β-strand | 208-210 | 3 | 23 |
| α-helix | 211-213 | 3 | |
| β-strand | 215-218 | 4 | 23 |
| α-helix | 223-225 | 3 | |
| β-strand | 227-235 | 9 | 22 |
| β-strand | 238-249 | 12 | 22 |
| β-strand | 257-258 | 2 | 24 |
| α-helix | 259 | 1 | |
| α-helix | 264-265 | 2 | |
| β-strand | 266-269 | 4 | 25 |
| β-strand | 274-277 | 4 | 26 |
| β-strand | 280-281 | 2 | 24 |
| α-helix | 285-286 | 2 | |
| β-strand | 287-293 | 7 | 25 |
| β-strand | 309-314 | 6 | 25 |
| α-helix | 321-324 | 4 | |
| β-strand | 326-329 | 4 | 26 |
| β-strand | 338-345 | 8 | 25 |
| β-strand | 350-360 | 11 | 25 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heparin-binding growth factor 2 | A, B, C, D | protein | 155 | Homo sapiens | P09038 (AlphaFold model) |
| Fibroblast growth factor receptor 2 | E, F, G, H | protein | 220 | Homo sapiens | P21802 (AlphaFold model) |
>1II4_1 HEPARIN-BINDING GROWTH FACTOR 2 (chains A, B, C, D) MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKY TSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
>1II4_2 FIBROBLAST GROWTH FACTOR RECEPTOR 2 (chains E, F, G, H) NSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGG YKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLDVVERWPHRPILQAGLPANA STVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEV LYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGRE
Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome. Ibrahimi, O.A., Eliseenkova, A.V., Plotnikov, A.N. et al. Proc Natl Acad Sci U S A (2001) 98:7182-7187. DOI 10.1073/pnas.121183798 · PubMed
Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1II4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.