Crystal structure of merlin FERM domain. Determined by X-ray diffraction at 2.9 Å resolution. Released 3 Apr 2002.
Explore 1ISN in 3D Show helices and sheets RCSB PDB PDBe
1ISN contains 11 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 42 | 1 | 2 |
| α-helix | 43-54 | 12 | |
| α-helix | 59-61 | 3 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 72-74 | 3 | 1 |
| β-strand | 80 | 1 | 2 |
| β-strand | 92-98 | 7 | 1 |
| α-helix | 105-108 | 4 | |
| α-helix | 112-127 | 16 | |
| α-helix | 135-150 | 16 | |
| α-helix | 171-174 | 4 | |
| α-helix | 181-194 | 14 | |
| α-helix | 200-212 | 13 | |
| β-strand | 220-222 | 3 | 3 |
| β-strand | 225 | 1 | 4 |
| β-strand | 231 | 1 | 4 |
| β-strand | 233-236 | 4 | 3 |
| β-strand | 240-244 | 5 | 3 |
| β-strand | 245 | 1 | 5 |
| β-strand | 248 | 1 | 5 |
| β-strand | 254-257 | 4 | 3 |
| β-strand | 261-267 | 7 | 4 |
| β-strand | 270-275 | 6 | 4 |
| β-strand | 285-286 | 2 | 4 |
| α-helix | 292-311 | 20 | |
| α-helix | 313-315 | 3 | |
| α-helix | 316-337 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| merlin | A | protein | 323 | Mus musculus | P46662 (AlphaFold model) |
>1ISN_1 merlin (chains A) QPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKM DKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKVYCPPEA SVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRG RARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGVDALGLHIYDPENRLTPKISFP WNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLE VQQMKAQAREEKARKQMERQRLA
Structural basis for neurofibromatosis type 2. Crystal structure of the merlin FERM domain. Shimizu, T., Seto, A., Maita, N. et al. J Biol Chem (2002) 277:10332-10336. DOI 10.1074/jbc.M109979200 · PubMed
Other PDB entries of the same protein (UniProt P46662 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1ISN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.