4P7I: Merlin FERM/DCAF1 complex

Crystal structure of the Merlin FERM/DCAF1 complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 5,107
Mol. weight: 88.94 kDa
Released: 9 Apr 2014

Explore 4P7I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4P7I contains 26 α-helices and 33 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	21-27	7	1
β-strand	32-38	7	1
β-strand	42	1	2
α-helix	43-54	12
α-helix	59-61	3
β-strand	62-68	7	1
β-strand	71-74	4	1
β-strand	80	1	2
α-helix	81-83	3
β-strand	92-98	7	1
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-150	16
α-helix	171-176	6
α-helix	181-192	12
α-helix	193-195	3
α-helix	200-211	12
α-helix	219	1
β-strand	220-226	7	3
β-strand	231-236	6	3
β-strand	240-244	5	3
β-strand	245	1	4
β-strand	248	1	4
β-strand	254-257	4	3
α-helix	258-260	3
β-strand	261-267	7	3
β-strand	270-275	6	3
α-helix	281-282	2
β-strand	283-286	4	3
α-helix	290-309	20

Chain B: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	5
β-strand	32-37	6	5
β-strand	42	1	6
α-helix	43-54	12
α-helix	59-61	3
β-strand	62-67	6	5
β-strand	72-74	3	5
β-strand	80	1	6
α-helix	81-83	3
β-strand	92-98	7	5
α-helix	105-108	4
α-helix	112-127	16
α-helix	135-150	16
α-helix	171-174	4
α-helix	181-192	12
α-helix	200-211	12
β-strand	220-225	6	7
β-strand	231-236	6	7
β-strand	240-244	5	7
β-strand	254-257	4	7
α-helix	258-260	3
β-strand	261-267	7	7
β-strand	270-275	6	7
α-helix	281-282	2
β-strand	283-286	4	7
α-helix	290-309	20

Chain C: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	1482-1486	5	3
β-strand	1501-1505	5	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1501-1504	4	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Merlin	A, B	protein	317	Mus musculus	P46662 (AlphaFold model)
Protein VPRBP	C, D	protein	67	Homo sapiens	Q9Y4B6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4P7I_1 Merlin (chains A, B)
GPGSMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGL
RETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQH
LFFLQVKKQILDEKVYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINL
YQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFTIRNKKGTELLLGV
DALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLI
LQLCIGNHDLFMRRRKA

Sequence of entity 2 (C, D), FASTA

>4P7I_2 Protein VPRBP (chains C, D)
GPGSEFGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEVELILGDTDSSDNSDLEDD
IILSLNE

Primary citation

Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1. Li, Y., Wei, Z., Zhang, J. et al. J Biol Chem (2014) 289:14674-14681. DOI 10.1074/jbc.M114.551184 · PubMed

Other PDB entries of the same protein (UniProt P46662 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WA0 2.31 Å, Crystal structure of merlin complexed with DCAF1/VprBP
4ZRK 2.32 Å, Merlin-FERM and Lats1 complex
1ISN 2.9 Å, Crystal structure of merlin FERM domain

Browse structure collections

About this viewer

MolViewer shows 4P7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.