1ITP: POIA1

Solution Structure of POIA1. Determined by solution NMR. Released 13 Feb 2002.

Method: Solution NMR
Organism: Pleurotus ostreatus
Chains: 1
Atoms: 583
Mol. weight: 8.33 kDa
Released: 13 Feb 2002

Explore 1ITP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ITP contains 2 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
α-helix	16-29	14
β-strand	35-39	5	1
β-strand	42-49	8	1
α-helix	51-59	9
β-strand	65-70	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
proteinase A inhibitor 1	A	protein	77	Pleurotus ostreatus	Q7M4T6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ITP_1 proteinase A inhibitor 1 (chains A)
GSAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGL
QGDLIDSIEEDGIVTTQ

Primary citation

Structure of POIA1, a homologous protein to the propeptide of subtilisin: implication for protein foldability and the function as an intramolecular chaperone. Sasakawa, H., Yoshinaga, S., Kojima, S. et al. J Mol Biol (2002) 317:159-167. DOI 10.1006/jmbi.2002.5412 · PubMed

Other PDB entries of the same protein (UniProt Q7M4T6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1V5I 1.5 Å, Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'

Browse structure collections

About this viewer

MolViewer shows 1ITP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.