Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'. Determined by X-ray diffraction at 1.5 Å resolution. Released 8 Mar 2005.
Explore 1V5I in 3D Show helices and sheets RCSB PDB PDBe
1V5I contains 13 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-10 | 5 | |
| α-helix | 13-17 | 5 | |
| β-strand | 27-32 | 6 | 1 |
| β-strand | 44-49 | 6 | 1 |
| β-strand | 51 | 1 | 2 |
| β-strand | 54 | 1 | 2 |
| α-helix | 64-73 | 10 | |
| β-strand | 89-94 | 6 | 1 |
| β-strand | 101-103 | 3 | 3 |
| α-helix | 104-116 | 13 | |
| β-strand | 121-124 | 4 | 1 |
| β-strand | 127 | 1 | 3 |
| β-strand | 128 | 1 | 4 |
| α-helix | 133-144 | 12 | |
| β-strand | 148-152 | 5 | 1 |
| β-strand | 167 | 1 | 4 |
| β-strand | 175-180 | 6 | 1 |
| α-helix | 185 | 1 | |
| β-strand | 186 | 1 | 1 |
| α-helix | 187 | 1 | |
| β-strand | 198-201 | 4 | 1 |
| β-strand | 205-209 | 5 | 5 |
| β-strand | 213-217 | 5 | 5 |
| α-helix | 220-237 | 18 | |
| α-helix | 243-252 | 10 | |
| β-strand | 255 | 1 | 1 |
| α-helix | 260-263 | 4 | |
| β-strand | 267 | 1 | 1 |
| α-helix | 270-273 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 6 |
| α-helix | 15-28 | 14 | |
| β-strand | 34-38 | 5 | 6 |
| β-strand | 41-48 | 8 | 6 |
| α-helix | 50-58 | 9 | |
| β-strand | 60 | 1 | 6 |
| β-strand | 64-69 | 6 | 6 |
| β-strand | 72-74 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Subtilisin BPN' | A | protein | 275 | Bacillus amyloliquefaciens | P00782 (AlphaFold model) |
| IA-1=serine proteinase inhibitor | B | protein | 76 | Pleurotus ostreatus | Q7M4T6 (AlphaFold model) |
>1V5I_1 Subtilisin BPN' (chains A) AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQD NNSHGTHVAGTVAALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMD VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAV DSSNQRASFSSVGPELDVMAPGVSIQSTLPGNKYGAYNGTCMASPHVAGAAALILSKHPN WTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ
>1V5I_2 IA-1=serine proteinase inhibitor (chains B) SAGKFIVIFKNDVSEDKIRETKDEVIAEGGTITNEYNMPGMKGFAGELTPQSLTKFQGLQ GDLIDSIEEDHVAHAY
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (GOL, SO4) are not listed.
Crystal structure of serine protease inhibitor POIA1 in complex with subtilisin BPN'. Lee, W.C., Kikkawa, M., Kojima, S. et al. To be published.
Other PDB entries of the same protein (UniProt P00782 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1V5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.