1IWM: Outer Membrane Lipoprotein Receptor, LolB

Crystal Structure of the Outer Membrane Lipoprotein Receptor, LolB. Determined by X-ray diffraction at 1.9 Å resolution. Released 15 Jul 2003.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Escherichia coli
Chains: 2
Atoms: 3,105
Mol. weight: 42.84 kDa
Released: 15 Jul 2003

Explore 1IWM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IWM contains 6 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	16-26	11
β-strand	30-40	11	1
β-strand	45-55	11	1
β-strand	59-65	7	1
β-strand	71-78	8	1
β-strand	81-85	5	1
β-strand	91-94	4	1
α-helix	97-105	9
α-helix	111-117	7
β-strand	128-130	3	1
β-strand	136-142	7	1
β-strand	147-152	6	1
β-strand	155-156	2	2
β-strand	163-164	2	2
β-strand	166-170	5	1
β-strand	175-185	11	1

Chain B: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	16-26	11
β-strand	30-40	11	3
β-strand	45-55	11	3
β-strand	59-65	7	3
β-strand	71-78	8	3
β-strand	81-85	5	3
β-strand	91-94	4	3
α-helix	97-105	9
α-helix	111-117	7
β-strand	128-130	3	3
β-strand	136-143	8	3
β-strand	146-152	7	3
β-strand	155-156	2	4
β-strand	163-164	2	4
β-strand	166-171	6	3
β-strand	174-185	12	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer Membrane Lipoprotein LolB	A, B	protein	186	Escherichia coli	P61320 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1IWM_1 Outer Membrane Lipoprotein LolB (chains A, B)
ASVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRY
RLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILG
LPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKM
DNWIVK

Primary citation

Crystal structures of bacterial lipoprotein localization factors, LolA and LolB. Takeda, K., Miyatake, H., Yokota, N. et al. EMBO J (2003) 22:3199-3209. DOI 10.1093/emboj/cdg324 · PubMed

Other PDB entries of the same protein (UniProt P61320 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3WJT 1.55 Å, Crystal structure of the L68D variant of mLolB
1IWN 2.2 Å, Crystal Structure of the Outer Membrane Lipoprotein Receptor LolB Complexed with…
3WJV 2.4 Å, Crystal structure of the L68E variant of mLolB
3WJU 2.5 Å, Crystal structure of the L68D variant of mLolB from Escherichia coli
9RLG 3.09 Å, LolCDE complex with LolB lipoprotein
9RLH 3.19 Å, LolCDE complex with del 9-15 LolB lipoprotein

Browse structure collections

About this viewer

MolViewer shows 1IWM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.