3WJT: L68D variant of mLolB

Crystal structure of the L68D variant of mLolB. Determined by X-ray diffraction at 1.55 Å resolution. Released 5 Mar 2014.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Escherichia coli
Chains: 1
Atoms: 1,661
Mol. weight: 20.81 kDa
Released: 5 Mar 2014

Explore 3WJT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WJT contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	1
α-helix	16-26	11
β-strand	31-41	11	1
β-strand	44-56	13	1
β-strand	59-65	7	1
β-strand	71-78	8	1
β-strand	81-86	6	1
β-strand	91-94	4	1
α-helix	97-102	6
α-helix	111-117	7
β-strand	127-130	4	1
β-strand	136-143	8	1
β-strand	146-152	7	1
β-strand	155-156	2	2
β-strand	163-164	2	2
β-strand	166-170	5	1
β-strand	174-185	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer-membrane lipoprotein LolB	A	protein	178	Escherichia coli	P61320 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WJT_1 Outer-membrane lipoprotein LolB (chains A)
PGKSPDSPQWRQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPD
GSTELELNAQPGNVQLVDNKGQRYTADDAEEMIGKLTGMPIPLNSLRQWILGLPGDATDY
KLDDQYRLSEITYSQNGKNWKVVYGGYDTKTQPAMPANMELTDGGQRIKLKMDNWIVK

Primary citation

Roles of the Protruding Loop of Factor B Essential for the Localization of Lipoproteins (LolB) in the Anchoring of Bacterial Triacylated Proteins to the Outer Membran. Hayashi, Y., Tsurumizu, R., Tsukahara, J. et al. J Biol Chem (2014) 289:10530-10539. DOI 10.1074/jbc.M113.539270 · PubMed

Other PDB entries of the same protein (UniProt P61320 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1IWM 1.9 Å, Crystal Structure of the Outer Membrane Lipoprotein Receptor, LolB
1IWN 2.2 Å, Crystal Structure of the Outer Membrane Lipoprotein Receptor LolB Complexed with…
3WJV 2.4 Å, Crystal structure of the L68E variant of mLolB
3WJU 2.5 Å, Crystal structure of the L68D variant of mLolB from Escherichia coli
9RLG 3.09 Å, LolCDE complex with LolB lipoprotein
9RLH 3.19 Å, LolCDE complex with del 9-15 LolB lipoprotein

Browse structure collections

About this viewer

MolViewer shows 3WJT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.