1IXD: Cylindromatosis tumour-suppressor CYLD

Solution structure of the CAP-GLY domain from human cylindromatosis tomour-suppressor CYLD. Determined by solution NMR. Released 19 Dec 2002.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 762
Mol. weight: 10.87 kDa
Released: 19 Dec 2002

Explore 1IXD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IXD contains 1 α-helix and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	23-26	4	1
β-strand	34-40	7	1
β-strand	49-54	6	1
β-strand	59	1	2
β-strand	61	1	2
β-strand	62	1	3
β-strand	65-66	2	4
β-strand	69-70	2	4
β-strand	79	1	3
β-strand	80-83	4	1
α-helix	84-86	3
β-strand	87-89	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cylindromatosis tumour-suppressor CYLD	A	protein	104	Homo sapiens	Q9NQC7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IXD_1 Cylindromatosis tumour-suppressor CYLD (chains A)
GSSGSSGLAMPPGNSHGLEVGSLAEVKENPPFYGVIRWIGQPPGLNEVLAGLELEDECAG
CTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPSGPSSG

Primary citation

The CAP-Gly domain of CYLD associates with the proline-rich sequence in NEMO/IKKgamma. Saito, K., Kigawa, T., Koshiba, S. et al. Structure (2004) 12:1719-1728. DOI 10.1016/j.str.2004.07.012 · PubMed

Other PDB entries of the same protein (UniProt Q9NQC7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OWD 1.71 Å, Structure of CYLD CAP-Gly3 (467-552) bound to Ub; tetragonal space group
9TMK 1.8 Å, Structure of CYLD CAP-Gly2 bound to Listeria effector protein InlC
7OWC 1.85 Å, Structure of CYLD CAP-Gly3 (467-565) bound to Ub; orthorhobic space group
2VHF 2.8 Å, Structure of the CYLD USP domain
1WHL Solution structure of the 1st CAP-Gly domain in human cylindromatosis tumor suppressor…
1WHM Solution structure of the 2nd CAP-Gly domain in human cylindromatosis tumor suppressor…

Browse structure collections

About this viewer

MolViewer shows 1IXD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.