1IXV: Probable 26S proteasome regulatory subunit p28

Crystal Structure Analysis of homolog of oncoprotein gankyrin, an interactor of Rb and CDK4/6. Determined by X-ray diffraction at 2.3 Å resolution. Released 16 Dec 2003.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,916
Mol. weight: 25.93 kDa
Released: 16 Dec 2003

Explore 1IXV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1IXV contains 17 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	5-12	8
α-helix	15-24	10
α-helix	26-28	3
α-helix	39-45	7
α-helix	49-56	8
α-helix	64-66	3
α-helix	75-82	8
α-helix	85-92	8
α-helix	110-116	7
α-helix	120-128	9
α-helix	143-150	8
α-helix	153-157	5
α-helix	158-162	5
α-helix	177-183	7
α-helix	187-197	11
α-helix	212-214	3
α-helix	218-227	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable 26S proteasome regulatory subunit p28	A	protein	231	Saccharomyces cerevisiae	P50086 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1IXV_1 Probable 26S proteasome regulatory subunit p28 (chains A)
MSNYPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKME
NVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWF
EVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFH
ALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNVVDA

Primary citation

Crystal structure of the homolog of the oncoprotein gankyrin, an interactor of Rb and CDK4/6. Padmanabhan, B., Adachi, N., Kataoka, K. et al. J Biol Chem (2004) 279:1546-1552. DOI 10.1074/jbc.M310266200 · PubMed

Other PDB entries of the same protein (UniProt P50086 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DZN 2.2 Å, Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
1WG0 2.53 Å, Structural comparison of Nas6p protein structures in two different crystal forms
2DZO 3.0 Å, Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3
35ZW 3.31 Å, yeast 26S proteasome base assembly intermediate, Hsm3-Rpt1-Rpt2-Rpt3-Rpt4-Rpt5…
36BM 3.82 Å, yeast 26S proteasome base assembly intermediate, base-Hsm3-Nas6 with Rpt4-EQ
36BL 3.91 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6(2) with Rpt4-EQ
36BD 3.93 Å, yeast 26S proteasome base assembly intermediate, base-Rpn14-Hsm3-Nas6 with Rpt4-EQ
36AX 4.87 Å, yeast 26S proteasome base assembly intermediate, base-Nas2-Rpn14-Hsm3-Nas6 with Rpt4-EQ

Browse structure collections

About this viewer

MolViewer shows 1IXV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.