1J19: Radxin FERM domain

Crystal structure of the radxin FERM domain complexed with the ICAM-2 cytoplasmic peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 11 Mar 2003.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,966
Mol. weight: 39.31 kDa
Released: 11 Mar 2003

Explore 1J19 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J19 contains 14 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	16-20	5	1
β-strand	25	1	2
α-helix	26-37	12
α-helix	42-44	3
β-strand	45-50	6	1
β-strand	56-58	3	1
β-strand	64	1	2
α-helix	70-72	3
β-strand	76-82	7	1
α-helix	89-92	4
α-helix	96-111	16
α-helix	119-134	16
α-helix	155-160	6
α-helix	165-177	13
α-helix	184-195	12
β-strand	204-210	7	3
β-strand	215-221	7	3
β-strand	224-229	6	3
β-strand	238-241	4	3
α-helix	242-244	3
β-strand	245-251	7	3
β-strand	254-259	6	3
α-helix	265-266	2
β-strand	267-270	4	3
α-helix	274-293	20
α-helix	300-311	12

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	407-410	4	3
α-helix	413-415	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
radixin	A	protein	317	Mus musculus	P26043 (AlphaFold model)
16-mer peptide from Intercellular adhesion molecule-2	B	protein	16	Mus musculus	P35330 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J19_1 radixin (chains A)
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQARVDSSGAA

Sequence of entity 2 (B), FASTA

>1J19_2 16-mer peptide from Intercellular adhesion molecule-2 (chains B)
RRRTGTYGVLAAWRRL

Primary citation

Structural basis of adhesion-molecule recognition by ERM proteins revealed by the crystal structure of the radixin-ICAM-2 complex. Hamada, K., Shimizu, T., Yonemura, S. et al. EMBO J (2003) 22:502-514. DOI 10.1093/emboj/cdg039 · PubMed

Other PDB entries of the same protein (UniProt P26043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2ZPY 2.1 Å, Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44…
3X23 2.4 Å, Radixin complex
2D10 2.5 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail…
1GC7 2.8 Å, Crystal structure of the radixin ferm domain
2D2Q 2.8 Å, Crystal structure of the dimerized radixin FERM domain
2EMT 2.8 Å, Crystal Structure Analysis of the radixin FERM domain complexed with adhesion molecule…
2D11 2.81 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail…
1GC6 2.9 Å, Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
2EMS 2.9 Å, Crystal Structure Analysis of the radixin FERM domain complexed with adhesion molecule…
2YVC 3.2 Å, Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail

Browse structure collections

About this viewer

MolViewer shows 1J19 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.