2ZPY: Mouse radxin FERM domain

Crystal structure of the mouse radxin FERM domain complexed with the mouse CD44 cytoplasmic peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 26 Aug 2008.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,714
Mol. weight: 39.11 kDa
Released: 26 Aug 2008

Explore 2ZPY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2ZPY contains 12 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	15-20	6	1
β-strand	25	1	2
α-helix	26-36	11
α-helix	42-44	3
β-strand	45-50	6	1
β-strand	51	1	3
β-strand	56-58	3	1
α-helix	59-60	2
β-strand	64	1	2
α-helix	65-67	3
β-strand	70	1	3
β-strand	76-82	7	1
α-helix	89-91	3
α-helix	96-111	16
α-helix	119-134	16
α-helix	155-160	6
α-helix	165-178	14
α-helix	184-195	12
β-strand	204-210	7	4
β-strand	215-221	7	4
β-strand	224-229	6	4
β-strand	232	1	4
β-strand	238-241	4	4
α-helix	242-244	3
β-strand	245-251	7	4
β-strand	254-259	6	4
β-strand	267-270	4	4
α-helix	274-293	20

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	300-304	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Radixin	A	protein	312	Mus musculus	P26043 (AlphaFold model)
CD44 antigen	B	protein	20		P15379 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2ZPY_1 Radixin (chains A)
GPMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTW
LKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCP
PETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEE
HRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKI
GFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPD
TIEVQQMKAQAR

Sequence of entity 2 (B), FASTA

>2ZPY_2 CD44 antigen (chains B)
SRRRCGQKKKLVINGGNGTV

Primary citation

Structural basis for CD44 recognition by ERM proteins. Mori, T., Kitano, K., Terawaki, S. et al. J Biol Chem (2008) 283:29602-29612. DOI 10.1074/jbc.M803606200 · PubMed

Other PDB entries of the same protein (UniProt P26043 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3X23 2.4 Å, Radixin complex
1J19 2.4 Å, Crystal structure of the radxin FERM domain complexed with the ICAM-2 cytoplasmic peptide
2D10 2.5 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail…
1GC7 2.8 Å, Crystal structure of the radixin ferm domain
2D2Q 2.8 Å, Crystal structure of the dimerized radixin FERM domain
2EMT 2.8 Å, Crystal Structure Analysis of the radixin FERM domain complexed with adhesion molecule…
2D11 2.81 Å, Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail…
1GC6 2.9 Å, Crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
2EMS 2.9 Å, Crystal Structure Analysis of the radixin FERM domain complexed with adhesion molecule…
2YVC 3.2 Å, Crystal structure of the Radixin FERM domain complexed with the NEP cytoplasmic tail

Browse structure collections

About this viewer

MolViewer shows 2ZPY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.