1J1M: Ricin A-Chain (Recombinant) at 100K

Ricin A-Chain (Recombinant) at 100K. Determined by X-ray diffraction at 1.5 Å resolution. Released 3 Feb 2004.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Ricinus communis
Chains: 1
Atoms: 2,531
Mol. weight: 30.95 kDa
Released: 3 Feb 2004

Explore 1J1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J1M contains 17 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
α-helix	18-32	15
β-strand	38-39	2	2
β-strand	42-43	2	2
β-strand	44	1	3
α-helix	45-47	3
α-helix	53-55	3
β-strand	57-63	7	1
β-strand	69-75	7	1
β-strand	81-86	6	1
β-strand	89-92	4	1
α-helix	93-95	3
α-helix	98-103	6
α-helix	104-106	3
β-strand	113-116	4	1
α-helix	123-130	8
α-helix	134-136	3
β-strand	139	1	4
α-helix	141-152	12
α-helix	154-156	3
α-helix	161-171	11
α-helix	172-177	6
α-helix	178-180	3
α-helix	182-193	12
β-strand	198	1	4
α-helix	202-220	19
β-strand	222	1	5
β-strand	225-233	9	5
β-strand	239-244	6	5
α-helix	245-248	4
β-strand	255	1	3
α-helix	260-263	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ricin	A	protein	268	Ricinus communis	P02879 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J1M_1 Ricin (chains A)
MIFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFIL
VELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAF
GGNYDRLEQLAGNLREDIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAA
RFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSK
FSVYDVSILIPIIALMVYRCAPPPSSQF

Primary citation

Ricin A-Chain (Recombinant) at 100K. Watanabe, K., Motoshima, H. To be published.

Other PDB entries of the same protein (UniProt P02879 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Y07 1.25 Å, Crystal structure of Ricin A chain bound with (S)-2-amino-N-(1-hydroxy-3-phenylpropan-2-y…
7Y08 1.25 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
3PX8 1.29 Å, RTA in complex with 7-carboxy-pterin
7XZT 1.3 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
7TGF 1.35 Å, Single-domain VHH intrabodies neutralize ricin toxin.
7Y03 1.35 Å, Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7…
7Y06 1.35 Å, Crystal structure of Ricin A chain bound with (S)-2-(2-amino-4-oxo-3,4-dihydropteridine-7…
2VC4 1.39 Å, Ricin A-Chain (Recombinant) E177D Mutant
1UQ5 1.4 Å, Ricin a-chain (recombinant) N122A mutant
7XZW 1.45 Å, Crystal structure of Ricin A chain bound with (2-amino-4-oxo-3,4-dihydropteridine-7-carbo…
7Y4M 1.45 Å, Crystal structure of Ricin A chain bound with N2-(2-amino-4-oxo-3,4-dihydropteridine-7-ca…
4Z9K 1.5 Å, Ricin A chain bound to camelid nanobody (VHH2)(F5)

Browse structure collections

About this viewer

MolViewer shows 1J1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.