The Crystal Structure of Ca+-bound Human S100P Determined at 2.0A Resolution by X-ray. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Jan 2003.
Explore 1J55 in 3D Show helices and sheets RCSB PDB PDBe
1J55 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-18 | 16 | |
| β-strand | 27-28 | 2 | 1 |
| α-helix | 30-40 | 11 | |
| α-helix | 53-61 | 9 | |
| β-strand | 69-70 | 2 | 1 |
| α-helix | 71-92 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| S-100P protein | A | protein | 95 | Homo sapiens | P25815 (AlphaFold model) |
>1J55_1 S-100P PROTEIN (chains A) MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
The Crystal Structure at 2A Resolution of the Ca2+-binding Protein S100P. Zhang, H., Wang, G., Ding, Y. et al. J Mol Biol (2003) 325:785-794. DOI 10.1016/S0022-2836(02)01278-0 · PubMed
Other PDB entries of the same protein (UniProt P25815 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1J55 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.