2MJW: PDB entry 2MJW

Structural Insights into Calcium Bound S100P - V Domain of the receptor for advanced glycation end products (RAGE) Complex. Determined by solution NMR. Released 5 Nov 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 4
Atoms: 3,014
Mol. weight: 43 kDa
Released: 5 Nov 2014

Explore 2MJW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MJW contains 8 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	1
β-strand	32-37	6	2
β-strand	48	1	3
β-strand	49	1	4
β-strand	52-54	3	1
β-strand	64	1	4
β-strand	65	1	5
β-strand	68	1	5
β-strand	77-79	3	2
β-strand	83-89	7	2
β-strand	96-98	3	1
β-strand	102	1	3
β-strand	103	1	6
β-strand	107	1	6
β-strand	113-117	5	1

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-18	16
β-strand	28	1	7
α-helix	30-37	8
α-helix	52-61	10
β-strand	69	1	7
α-helix	71-92	22

Chain C: 0 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	9
β-strand	32-37	6	10
β-strand	48	1	11
β-strand	49	1	12
β-strand	52-54	3	9
β-strand	64	1	12
β-strand	77-79	3	10
β-strand	83-89	7	10
β-strand	96-98	3	9
β-strand	102	1	11
β-strand	103	1	13
β-strand	107	1	13
β-strand	113-117	5	9

Chain D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	97-110	14
β-strand	121-122	2	8
α-helix	124-131	8
α-helix	147-155	9
β-strand	163-164	2	8
α-helix	165-184	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Advanced glycosylation end product-specific receptor	A, C	protein	101	Homo sapiens	Q15109 (AlphaFold model)
Protein S100-P	B, D	protein	94	Homo sapiens	P25815 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>2MJW_1 Advanced glycosylation end product-specific receptor (chains A, C)
AMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLP
NGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIP

Sequence of entity 2 (B, D), FASTA

>2MJW_2 Protein S100-P (chains B, D)
MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL

Primary citation

Structural insights into calcium-bound S100P and the V domain of the RAGE complex. Penumutchu, S.R., Chou, R.H., Yu, C. PLoS One (2014) 9:e103947-e103947. DOI 10.1371/journal.pone.0103947 · PubMed

Other PDB entries of the same protein (UniProt Q15109 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D7F 1.3 Å, X-ray structure of Ca(2+)-S100B with human RAGE-derived W72 peptide
3O3U 1.5 Å, Crystal Structure of Human Receptor for Advanced Glycation Endproducts (RAGE)
6XQ1 1.51 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with…
6XQ3 1.71 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with…
6XQ5 1.8 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with Fragment 1
6XQ7 1.8 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with Fragment 5
6XQ8 1.82 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with Fragments 1 & 11
3CJJ 1.85 Å, Crystal structure of human rage ligand-binding domain
6XQ6 1.9 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with Fragment 11
7LML 2.15 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with…
4P2Y 2.3 Å, Crystal structure of the human RAGE ectodomain (fragment VC1C2) in complex with mouse…
6XQ9 2.3 Å, Receptor for Advanced Glycation End Products VC1 domain in complex with Fragments 1 & 13

Browse structure collections

About this viewer

MolViewer shows 2MJW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.