Low Temperature (100K) Crystal Structure of Flavodoxin D. vulgaris S35C Mutant at 1.44 Angstrom Resolution. Determined by X-ray diffraction at 1.44 Å resolution. Released 5 Sept 2001.
Explore 1J9E in 3D Show helices and sheets RCSB PDB PDBe
1J9E contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| α-helix | 14-28 | 15 | |
| β-strand | 32-37 | 6 | 1 |
| α-helix | 38-40 | 3 | |
| β-strand | 52-57 | 6 | 1 |
| β-strand | 59-60 | 2 | 2 |
| β-strand | 66-67 | 2 | 2 |
| α-helix | 72-76 | 5 | |
| α-helix | 78-80 | 3 | |
| β-strand | 87-94 | 8 | 1 |
| α-helix | 103-114 | 12 | |
| β-strand | 118-119 | 2 | 1 |
| β-strand | 124-127 | 4 | 1 |
| α-helix | 130-133 | 4 | |
| α-helix | 134-147 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Flavodoxin | A | protein | 147 | Desulfovibrio vulgaris | P00323 (AlphaFold model) |
>1J9E_1 FLAVODOXIN (chains A) AKALIVYGSTTGNTEYTAETIARELADAGYEVDCRDAASVEAGGLFEGFDLVLLGCSTWG DDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQ DGLRIDGDPRAARDDIVGWAHDVRGAI
| ID | Name | Formula | Copies |
|---|---|---|---|
| FMN | Flavin mononucleotide | C17 H21 N4 O9 P | 1 |
Comparison of the refined crystal structures of wild-type (1.34 A) flavodoxin from Desulfovibrio vulgaris and the S35C mutant (1.44 A) at 100 K. Artali, R., Bombieri, G., Meneghetti, F. et al. Acta Crystallogr D Biol Crystallogr (2002) 58:1787-1792. DOI 10.1107/S0907444902012234 · PubMed
Other PDB entries of the same protein (UniProt P00323 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1J9E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.