Crystal structure of NTF2 M118E mutant. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Mar 2002.
Explore 1JB5 in 3D Show helices and sheets RCSB PDB PDBe
1JB5 contains 7 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-24 | 19 | |
| α-helix | 26-32 | 7 | |
| β-strand | 33-41 | 9 | 1 |
| β-strand | 44-47 | 4 | 1 |
| α-helix | 49-56 | 8 | |
| β-strand | 64-75 | 12 | 1 |
| β-strand | 81-91 | 11 | 1 |
| β-strand | 94-108 | 15 | 1 |
| β-strand | 111-122 | 12 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-24 | 19 | |
| α-helix | 26-32 | 7 | |
| β-strand | 33-41 | 9 | 2 |
| β-strand | 44-47 | 4 | 2 |
| α-helix | 49-58 | 10 | |
| β-strand | 64-75 | 12 | 2 |
| β-strand | 81-91 | 11 | 2 |
| α-helix | 95-96 | 2 | |
| β-strand | 97-107 | 11 | 2 |
| β-strand | 112-121 | 10 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear transport factor 2 | A, B | protein | 127 | Rattus norvegicus | P61972 (AlphaFold model) |
>1JB5_1 NUCLEAR TRANSPORT FACTOR 2 (chains A, B) MGDKPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLP FQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDEFR LALHNFG
NTF2 monomer-dimer equilibrium. Chaillan-Huntington, C., Butler, P.J., Huntington, J.A. et al. J Mol Biol (2001) 314:465-477. DOI 10.1006/jmbi.2001.5136 · PubMed
Other PDB entries of the same protein (UniProt P61972 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1JB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.