1JB5: NTF2 M118E mutant

Crystal structure of NTF2 M118E mutant. Determined by X-ray diffraction at 2.3 Å resolution. Released 13 Mar 2002.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,098
Mol. weight: 28.95 kDa
Released: 13 Mar 2002

Explore 1JB5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JB5 contains 7 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-24	19
α-helix	26-32	7
β-strand	33-41	9	1
β-strand	44-47	4	1
α-helix	49-56	8
β-strand	64-75	12	1
β-strand	81-91	11	1
β-strand	94-108	15	1
β-strand	111-122	12	1

Chain B: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-24	19
α-helix	26-32	7
β-strand	33-41	9	2
β-strand	44-47	4	2
α-helix	49-58	10
β-strand	64-75	12	2
β-strand	81-91	11	2
α-helix	95-96	2
β-strand	97-107	11	2
β-strand	112-121	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear transport factor 2	A, B	protein	127	Rattus norvegicus	P61972 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1JB5_1 NUCLEAR TRANSPORT FACTOR 2 (chains A, B)
MGDKPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLP
FQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDEFR
LALHNFG

Primary citation

NTF2 monomer-dimer equilibrium. Chaillan-Huntington, C., Butler, P.J., Huntington, J.A. et al. J Mol Biol (2001) 314:465-477. DOI 10.1006/jmbi.2001.5136 · PubMed

Other PDB entries of the same protein (UniProt P61972 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GY6 1.6 Å, NTF2 from rat, ammonium sulphate conditions
1JB2 2.0 Å, Crystal structure of NTF2 M84E mutant
1JB4 2.23 Å, Crystal structure of NTF2 M102E mutant
1AR0 2.3 Å, Nuclear transport factor 2 (NTF2) E42K mutant
1ASK 2.3 Å, Nuclear transport factor 2 (NTF2) H66A mutant
1OUN 2.3 Å, Crystal structure of nuclear transport factor 2 (NTF2)
1QMA 2.5 Å, Nuclear Transport Factor 2 (NTF2) W7A mutant
1U5O 2.5 Å, Structure of the D23A mutant of the nuclear transport carrier NTF2
5BXQ 2.5 Å, Structure of the NTF2:RanGDP complex

Browse structure collections

About this viewer

MolViewer shows 1JB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.