1JBB: Ubiquitin Conjugating Enzyme, Ubc13

Ubiquitin Conjugating Enzyme, Ubc13. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Jun 2001.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,475
Mol. weight: 34.98 kDa
Released: 20 Jun 2001

Explore 1JBB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JBB contains 15 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	6-17	12
α-helix	19-20	2
β-strand	23-27	5	1
β-strand	34-40	7	1
α-helix	41-42	2
β-strand	51-57	7	1
α-helix	66-67	2
β-strand	68-71	4	1
β-strand	80	1	2
β-strand	86	1	2
α-helix	89-91	3
α-helix	101-113	13
α-helix	126-131	6
α-helix	133-147	15
β-strand	149	1	1

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	6-17	12
α-helix	19-20	2
β-strand	23-28	6	3
β-strand	31-40	10	3
α-helix	41-42	2
β-strand	51-57	7	3
β-strand	68-71	4	3
β-strand	77	1	4
β-strand	80	1	4
β-strand	85	1	3
β-strand	86	1	4
α-helix	89-91	3
α-helix	101-113	13
α-helix	126-131	6
α-helix	133-147	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ubiquitin conjugating enzyme E2-17.5 KDA	A, B	protein	153	Saccharomyces cerevisiae	P52490 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1JBB_1 ubiquitin conjugating enzyme E2-17.5 KDA (chains A, B)
MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD
DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP
LANDVAEDWIKNEQGAKAKAREWTKLYAKKKPE

Primary citation

Molecular insights into polyubiquitin chain assembly: crystal structure of the Mms2/Ubc13 heterodimer. VanDemark, A.P., Hofmann, R.M., Tsui, C. et al. Cell (2001) 105:711-720. DOI 10.1016/S0092-8674(01)00387-7 · PubMed

Other PDB entries of the same protein (UniProt P52490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GLT 1.45 Å, Crystal Structure of Yeast Ubc13 C87E
1JAT 1.6 Å, Mms2/Ubc13 Ubiquitin Conjugating Enzyme Complex
5OJW 2.0 Å, S. cerevisiae UBC13 - MMs2 complex
6ZHT 2.3 Å, Uba1-Ubc13 disulfide mediated complex
6ZHS 2.35 Å, Uba1 bound to two E2 (Ubc13) molecules
2GMI 2.5 Å, Mms2/Ubc13~Ubiquitin
4FH1 2.61 Å, S. cerevisiae Ubc13-N79A

Browse structure collections

About this viewer

MolViewer shows 1JBB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.