1JEI: Emerin

Name: PDB 1JEI: Lem domain of human inner nuclear membrane protein emerin
Published: 2001-07-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Lem domain of human inner nuclear membrane protein emerin. Determined by solution NMR. Released 4 Jul 2001.

Method: Solution NMR
Chains: 1
Atoms: 440
Mol. weight: 6.24 kDa
Released: 4 Jul 2001

Explore 1JEI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JEI contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	8-15	8
α-helix	28-30	3
α-helix	31-39	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Emerin	A	protein	53		P50402 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JEI_1 EMERIN (chains A)
DNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRLSPPSSS

Primary citation

Structural analysis of emerin, an inner nuclear membrane protein mutated in X-linked Emery-Dreifuss muscular dystrophy. Wolff, N., Gilquin, B., Courchay, K. et al. FEBS Lett (2001) 501:171-176. DOI 10.1016/S0014-5793(01)02649-7 · PubMed

Other PDB entries of the same protein (UniProt P50402 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDY 1.44 Å, Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of…
6GHD 2.1 Å, Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies…
6RPR 2.26 Å, LEM domain of Emerin mutant T43I in complex with BAF dimer and the Igfold of the lamin A/C
2ODC LEM-domain of the nuclear envelope protein emerin
2ODG Complex of barrier-to-autointegration factor and LEM-domain of emerin

Browse structure collections

About this viewer

MolViewer shows 1JEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.