6GHD: Emerin

Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies an interface disrupted in autosomal recessive progeroid diseases. Determined by X-ray diffraction at 2.1 Å resolution. Released 8 Aug 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 8
Atoms: 5,674
Mol. weight: 77.15 kDa
Released: 8 Aug 2018

Explore 6GHD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GHD contains 34 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C, D and E: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	19	1	6
α-helix	20-22	3
α-helix	28-36	9
β-strand	41	1	6
α-helix	42-51	10
α-helix	56-67	12
α-helix	71-88	18

Chains B and F: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	430-436	7	2
β-strand	440-445	6	3
β-strand	451-456	6	3
β-strand	462-463	2	4
β-strand	468-473	6	2
α-helix	477-478	2
β-strand	479-482	4	2
β-strand	488-489	2	4
β-strand	494-499	6	3
α-helix	500-502	3
α-helix	504-506	3
β-strand	507	1	3
β-strand	511-514	4	3
β-strand	525-531	7	2
β-strand	537-545	9	2

Chain G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
α-helix	28-43	16

Chain H: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
α-helix	31-43	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Emerin	G, H	protein	45	Homo sapiens	P50402 (AlphaFold model)
Barrier-to-autointegration factor	A, C, D, E	protein	88	Homo sapiens	O75531 (AlphaFold model)
Prelamin-A/C	B, F	protein	119	Homo sapiens	P02545 (AlphaFold model)

Sequence of entity 1 (G, H), FASTA

>6GHD_1 Emerin (chains G, H)
GDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQR

Sequence of entity 2 (A, C, D, E), FASTA

>6GHD_2 Barrier-to-autointegration factor (chains A, C, D, E)
TTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFRE
WLKDTAGANAKQSRDAFGALREWADAFL

Sequence of entity 3 (B, F), FASTA

>6GHD_3 Prelamin-A/C (chains B, F)
SSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLTYRFPPKF
TLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAMRKLVRS

Primary citation

Structural analysis of the ternary complex between lamin A/C, BAF and emerin identifies an interface disrupted in autosomal recessive progeroid diseases. Samson, C., Petitalot, A., Celli, F. et al. Nucleic Acids Res (2018) 46:10460-10473. DOI 10.1093/nar/gky736 · PubMed

Other PDB entries of the same protein (UniProt P50402 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDY 1.44 Å, Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of…
6RPR 2.26 Å, LEM domain of Emerin mutant T43I in complex with BAF dimer and the Igfold of the lamin A/C
1JEI Lem domain of human inner nuclear membrane protein emerin
2ODC LEM-domain of the nuclear envelope protein emerin
2ODG Complex of barrier-to-autointegration factor and LEM-domain of emerin

Browse structure collections

About this viewer

MolViewer shows 6GHD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.