1JFI: NC2-TBP-DNA Ternary Complex

Crystal Structure of the NC2-TBP-DNA Ternary Complex. Determined by X-ray diffraction at 2.62 Å resolution. Released 11 Jul 2001.

Method: X-ray diffraction
Resolution: 2.62 Å
Organism: Homo sapiens
Chains: 5
Atoms: 3,743
Mol. weight: 63.08 kDa
Released: 11 Jul 2001

Explore 1JFI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JFI contains 16 α-helices and 16 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-21	8
β-strand	30	1	1
α-helix	34-58	25
β-strand	65	1	2
α-helix	67-71	5

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	115-125	11
β-strand	131	1	2
α-helix	133-160	28
β-strand	166	1	1
α-helix	168-175	8
α-helix	176-180	5
α-helix	181-183	3
α-helix	184-210	27
α-helix	215-240	26

Chain C: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	363	1
β-strand	364-373	10	3
α-helix	380-386	7
β-strand	390-393	4	3
β-strand	397-405	9	3
β-strand	408-413	6	3
β-strand	418-422	5	3
α-helix	427-443	17
β-strand	451-463	13	3
β-strand	468	1	4
α-helix	470-476	7
α-helix	478-480	3
β-strand	481-482	2	3
β-strand	491-494	4	3
β-strand	501-504	4	3
β-strand	509-515	7	3
α-helix	518-533	16
β-strand	536	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tptpgpgpcptpaptpapapapapgpgpgpcptpcp*c)-3'	D	DNA	19
5'-d(ggpapgpcpcpcptptptptpaptpapgpcpcpap*a)-3'	E	DNA	19
Transcription Regulator NC2 alpha chain	A	protein	98	Homo sapiens	Q14919 (AlphaFold model)
Transcription Regulator NC2 beta chain	B	protein	179	Homo sapiens	Q01658 (AlphaFold model)
Tata-box-binding protein (TBP)	C	protein	185	Homo sapiens	P20226 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>1JFI_1 5'-D(*TP*TP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*TP*CP*C)-3' (chains D)
TTGGCTATAAAAGGGCTCC

Sequence of entity 2 (E), FASTA

>1JFI_2 5'-D(*G*GP*AP*GP*CP*CP*CP*TP*TP*TP*TP*AP*TP*AP*GP*CP*CP*AP*A)-3' (chains E)
GGAGCCCTTTTATAGCCAA

Sequence of entity 3 (A), FASTA

>1JFI_3 Transcription Regulator NC2 alpha chain (chains A)
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEGDPAANKARKEAELAAATAEQ

Sequence of entity 4 (B), FASTA

>1JFI_4 Transcription Regulator NC2 beta chain (chains B)
GPHMASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEI
CNKSEKKTISPEHVIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEE
LLRQQQELFAKARQQQAELAQQEWLQMQQAAQQAQLAAASASASNQAGSSQDEEDDDDI

Sequence of entity 5 (C), FASTA

>1JFI_5 TATA-BOX-BINDING PROTEIN (TBP) (chains C)
GSHMSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIF
SSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLV
LTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKG
FRKTT

Primary citation

Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex. Kamada, K., Shu, F., Chen, H. et al. Cell (2001) 106:71-81. DOI 10.1016/S0092-8674(01)00417-2 · PubMed

Browse structure collections

About this viewer

MolViewer shows 1JFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.