1JN6: Fab-Estradiol Complexes

Crystal Structure of Fab-Estradiol Complexes. Determined by X-ray diffraction at 2.7 Å resolution. Released 6 Feb 2002.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,213
Mol. weight: 46.14 kDa
Released: 6 Feb 2002

Explore 1JN6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1JN6 contains 13 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	9-11	3	2
β-strand	17-22	6	3
β-strand	23	1	1
α-helix	31-33	3
β-strand	36-41	6	2
β-strand	45-50	6	2
β-strand	64-69	6	3
β-strand	72-78	7	3
α-helix	82-84	3
β-strand	86-93	8	2
β-strand	98-100	3	2
β-strand	104-107	4	2
β-strand	114	1	4
β-strand	117-121	5	5
α-helix	122-124	3
α-helix	125-128	4
β-strand	132-142	11	5
β-strand	143	1	4
β-strand	148-153	6	6
β-strand	156-158	3	6
β-strand	162-164	3	5
α-helix	166-167	2
β-strand	168-170	3	5
β-strand	174-184	11	5
α-helix	185-190	6
β-strand	194-200	7	6
β-strand	203-209	7	6

Chain B: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	7
α-helix	7-9	3
β-strand	10-11	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	33-39	7	8
β-strand	46-52	7	8
β-strand	57-60	4	8
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-101	10	8
β-strand	104-109	6	8
β-strand	113-116	4	8
β-strand	122	1	9
β-strand	125-129	5	10
β-strand	140-150	11	10
β-strand	151	1	9
β-strand	156-159	4	11
α-helix	160-162	3
β-strand	168-170	3	10
α-helix	171-173	3
β-strand	174-176	3	10
β-strand	179-189	11	10
α-helix	190-192	3
β-strand	198-204	7	11
α-helix	205-207	3
β-strand	209-215	7	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
monoclonal anti-estradiol 10G6D6 Fab light chain	A	protein	210	Mus musculus	P01843 (AlphaFold model)
monoclonal anti-estradiol 10G6D6 Fab heavy chain	B	protein	218	Mus musculus	Q6PF95 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1JN6_1 monoclonal anti-estradiol 10G6D6 Fab light chain (chains A)
QAVVTQESALTTSPGETVTLTCRSSSGAITTSHYANWIQEKPDHLFTGLISGTNNRAPGV
PARFSGSLIGDKAALTITGAQTEDEAIYICALWFSNQFIFGSGTKVTVLGQPKSSPSVTL
FPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSY
LTLTARAWERHSSYSCQVTHEGHTVEKSLS

Sequence of entity 2 (B), FASTA

>1JN6_2 monoclonal anti-estradiol 10G6D6 Fab heavy chain (chains B)
EVQLQQSGAELARPGASVKLSCRTSGYSFTTYWMQWVRQRPGQGLEWIAAIYPGDDDARY
TQKFKGKATLTADRSSSIVYLQLNSLTSEDSAVYSCSRGRSLYYTMDYWGQGTSVTVSSA
KTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVSWNTGSLSSGVHTFPAVLQSDL
YTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP

Primary citation

Highly specific anti-estradiol antibodies: structural characterisation and binding diversity. Monnet, C., Bettsworth, F., Stura, E.A. et al. J Mol Biol (2002) 315:699-712. DOI 10.1006/jmbi.2001.5284 · PubMed

Other PDB entries of the same protein (UniProt P01843 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1JNH 2.85 Å, Crystal Structure of Fab-Estradiol Complexes

Browse structure collections

About this viewer

MolViewer shows 1JN6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.